BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS311B02f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0558 - 18504639-18505718 32 0.32 05_01_0594 - 5337804-5337976,5338282-5338436,5338591-5338745,533... 29 1.7 01_07_0112 - 41149461-41151674,41151688-41153265,41154344-411555... 28 5.2 02_03_0272 - 17146578-17146691,17146806-17146926,17147260-171473... 27 6.9 01_06_1788 - 39873900-39873986,39874009-39874137,39874180-398742... 27 9.1 >09_04_0558 - 18504639-18505718 Length = 359 Score = 31.9 bits (69), Expect = 0.32 Identities = 22/74 (29%), Positives = 34/74 (45%) Frame = +3 Query: 21 HE*LSPPMPHYATFVRPIMSQAHYKEVQSCLKKKLHIRCLKVPQKLSRGQGVKVLDSCPE 200 H L PP H+ +VR + + E ++ L+ KL L+ P+++ V PE Sbjct: 208 HFLLLPPTEHHRLYVRDYPAAHYAAEDEAELRLKLE---LEEPERIVPWSSVDPYPPSPE 264 Query: 201 EAGLLASSNPFILQ 242 EA ASS P + Sbjct: 265 EAAAQASSFPLYFE 278 >05_01_0594 - 5337804-5337976,5338282-5338436,5338591-5338745, 5338864-5338992,5339096-5339189,5339293-5339366, 5339716-5339851,5341546-5341562 Length = 310 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +1 Query: 217 LPAIPSFYKTYCVHTTSLCSLKSLDEPF 300 LP I Y T C T LC L+ L+ PF Sbjct: 11 LPPISKAYGTLCFFATVLCQLQILNPPF 38 >01_07_0112 - 41149461-41151674,41151688-41153265,41154344-41155507, 41155807-41156293,41156603-41156759,41157303-41157378 Length = 1891 Score = 27.9 bits (59), Expect = 5.2 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +3 Query: 171 GVKVLDSCPEEAGLLASSNPFILQNVLRSHYKP 269 G K L++ PE GLL S F++ N + Y P Sbjct: 1449 GCKGLETLPEGLGLLISLKKFVISNCPKLTYLP 1481 >02_03_0272 - 17146578-17146691,17146806-17146926,17147260-17147365, 17147469-17147551,17147688-17147815,17147897-17147983, 17148064-17148174,17148502-17148669,17148753-17148837, 17148921-17149037,17149127-17149203,17149299-17149370, 17150538-17150634,17150750-17150952,17151115-17151217, 17151324-17151391,17151461-17151514,17151595-17151704, 17151982-17152060,17152171-17152233,17153410-17153529, 17153913-17153969,17154071-17154187,17156426-17156476, 17156591-17156689,17156787-17156935,17158090-17158312 Length = 953 Score = 27.5 bits (58), Expect = 6.9 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = +2 Query: 53 CYFCEAYNVSGTL*RSPILPQKKTSYTLPE 142 CYF Y P+ P K++ Y LPE Sbjct: 762 CYFVNDYKQKNRDCLDPVCPHKRSDYGLPE 791 >01_06_1788 - 39873900-39873986,39874009-39874137,39874180-39874246, 39874874-39874909,39875146-39875292,39875772-39875899, 39876349-39876435,39876523-39876633,39877433-39877600, 39877665-39877749,39877826-39877942,39878051-39878127, 39879981-39880077,39880175-39880377,39880519-39880645, 39880687-39880754,39880855-39880908,39880990-39881108, 39881651-39881729,39881803-39881865,39882113-39882232, 39882718-39882774,39882872-39882988,39883122-39883172, 39883262-39883360,39883438-39883583,39883740-39883887 Length = 928 Score = 27.1 bits (57), Expect = 9.1 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = +2 Query: 53 CYFCEAYNVSGTL*RSPILPQKKTSYTLPE 142 CYF Y P+ P K+ Y LPE Sbjct: 723 CYFVNDYKQKNRDVLGPVCPHKRADYGLPE 752 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,078,800 Number of Sequences: 37544 Number of extensions: 222243 Number of successful extensions: 496 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 488 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 495 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -