BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS311B02f (521 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g59670.1 68416.m06657 expressed protein ; expression supporte... 29 2.5 At2g30530.1 68415.m03718 expressed protein 27 5.8 >At3g59670.1 68416.m06657 expressed protein ; expression supported by MPSS Length = 510 Score = 28.7 bits (61), Expect = 2.5 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 8/69 (11%) Frame = +3 Query: 48 HYATFVRPIMSQAHYKEVQSCLKKKLHIRCLKVP--------QKLSRGQGVKVLDSCPEE 203 H+ F+RP+M ++ + E++ ++L R L+ P +KL VL+SC E Sbjct: 131 HWRRFIRPLMWRSKWVELRI---RELESRALEYPKELELYDQEKLEANIDPSVLESCGEG 187 Query: 204 AGLLASSNP 230 L SNP Sbjct: 188 IKSLPFSNP 196 >At2g30530.1 68415.m03718 expressed protein Length = 371 Score = 27.5 bits (58), Expect = 5.8 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -3 Query: 423 NKAYIHQSQRSLNEPSEAF 367 NKAY + S +SLNEP F Sbjct: 90 NKAYEYTSMKSLNEPKRGF 108 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,113,839 Number of Sequences: 28952 Number of extensions: 192582 Number of successful extensions: 352 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 344 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 351 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 957410176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -