BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS311B01f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_0459 + 17420156-17420976,17422291-17424199 28 4.0 03_05_0222 + 22082863-22082938,22083261-22083333,22083451-220834... 28 4.0 03_01_0377 + 2940333-2940418,2940512-2940658,2940741-2940809,294... 28 5.2 12_02_0266 - 16582912-16584918,16585041-16585229 27 9.1 >08_02_0459 + 17420156-17420976,17422291-17424199 Length = 909 Score = 28.3 bits (60), Expect = 4.0 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = +1 Query: 4 SEIVTTTNIKKNEGFHCSSFRGCLGSGRP 90 S+I+TTT I CSSFRG L + RP Sbjct: 302 SKIITTTRISDVARSCCSSFRGHLYNIRP 330 >03_05_0222 + 22082863-22082938,22083261-22083333,22083451-22083496, 22083639-22083753,22083847-22083926,22084022-22084621, 22084718-22084822,22084916-22085248 Length = 475 Score = 28.3 bits (60), Expect = 4.0 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = -1 Query: 164 STRGRKDQHSDPGVRCASEWFYWVQGRPEPRQPRKE 57 ST G DQ + +R A V+G+PEP +P+K+ Sbjct: 415 STGGTVDQKTIDSIRQAIGQNIQVKGQPEPSEPQKK 450 >03_01_0377 + 2940333-2940418,2940512-2940658,2940741-2940809, 2940958-2941123,2941208-2941436,2941528-2942054 Length = 407 Score = 27.9 bits (59), Expect = 5.2 Identities = 17/45 (37%), Positives = 22/45 (48%) Frame = +2 Query: 65 VVASVLGDPEPSKTIQKRSGHLGHYADLYGHGLSSGIAVHAGPAF 199 VVA LG +PS + + + L HY D GHGL + G F Sbjct: 167 VVAKWLGLTKPSSSGRLATRGLAHYPD--GHGLDPRFKMFVGHGF 209 >12_02_0266 - 16582912-16584918,16585041-16585229 Length = 731 Score = 27.1 bits (57), Expect = 9.1 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +1 Query: 4 SEIVTTTNIKKNEGFHCSSFRGCLGSGRP 90 S I+TTT K CSSFRG + +P Sbjct: 97 SRIITTTRTKDVANACCSSFRGIVYKMKP 125 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,328,667 Number of Sequences: 37544 Number of extensions: 155616 Number of successful extensions: 489 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 482 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 489 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -