BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS311A10f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0417 - 2972877-2973876,2973946-2974851,2975823-2976616,297... 28 4.0 09_02_0469 - 9610883-9611338,9611749-9611871,9612199-9612375,961... 27 9.1 >06_01_0417 - 2972877-2973876,2973946-2974851,2975823-2976616, 2977887-2977977,2978305-2978384 Length = 956 Score = 28.3 bits (60), Expect = 4.0 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = -1 Query: 293 KLNCTTTFLRNFAYIQVSNDKIHINLLRKIHEFVEKSSFC 174 +L C FLRN Q+ +D++ I ++++ E S C Sbjct: 69 ELECMNAFLRNLTISQIHDDQVRI-WMKQVREIAYDSEDC 107 >09_02_0469 - 9610883-9611338,9611749-9611871,9612199-9612375, 9614416-9614501,9615519-9615678,9616122-9617438, 9619463-9620428,9621452-9621766 Length = 1199 Score = 27.1 bits (57), Expect = 9.1 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = -3 Query: 411 IANFLICIATLIGCLRDQNAELIHSRNSEANDQILEVR*KVEL 283 + +F + + C R + AE + SRNSE ++ E ++EL Sbjct: 796 VQSFSLSTRSSQSCQRSEKAEQVRSRNSEISEITYEEPAEIEL 838 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,968,060 Number of Sequences: 37544 Number of extensions: 212707 Number of successful extensions: 561 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 552 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 561 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -