BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS311A10f (521 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF101305-1|AAF98592.2| 179|Caenorhabditis elegans Hypothetical ... 27 8.1 AF045641-5|AAC02577.2| 554|Caenorhabditis elegans Hypothetical ... 27 8.1 >AF101305-1|AAF98592.2| 179|Caenorhabditis elegans Hypothetical protein C04F5.2 protein. Length = 179 Score = 27.1 bits (57), Expect = 8.1 Identities = 18/45 (40%), Positives = 22/45 (48%), Gaps = 3/45 (6%) Frame = -1 Query: 290 LNCTTTFLRNFAYIQVSNDK---IHINLLRKIHEFVEKSSFCCFL 165 LNCT+ LRN + V+ DK I I L + VE S F L Sbjct: 15 LNCTSVMLRNHFIVAVNVDKIAQISIGLYYALLILVESSLFFLLL 59 >AF045641-5|AAC02577.2| 554|Caenorhabditis elegans Hypothetical protein F53H1.3 protein. Length = 554 Score = 27.1 bits (57), Expect = 8.1 Identities = 15/46 (32%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = -2 Query: 280 QRHF*EILHTYKFRTTRFTS--IY*EKSMSSLKNLAFVVSFKHEDF 149 QRHF E+ H++ R+ S + +K MS K + F +DF Sbjct: 381 QRHFLELTHSFMIPMERYLSSLMPLKKEMSPFKGIPSTRPFSMDDF 426 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,125,209 Number of Sequences: 27780 Number of extensions: 219106 Number of successful extensions: 669 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 656 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 669 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1017709248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -