BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS311A10f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 24 1.1 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 23 1.9 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 23 1.9 DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 21 7.7 AY568009-1|AAS73299.1| 300|Apis mellifera ADP/ATP translocase p... 21 7.7 AY332626-1|AAQ24500.1| 300|Apis mellifera ADP/ATP translocase p... 21 7.7 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 23.8 bits (49), Expect = 1.1 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -2 Query: 160 HEDFCPCRLAARTTAKACLRTIIPRNRLVIVL 65 H D PC L A T A L + R++IVL Sbjct: 1101 HRDL-PCVLRASTPAPVVLEAVHASRRVLIVL 1131 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 23.0 bits (47), Expect = 1.9 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = -3 Query: 330 SEANDQILEVR*KVELHNDIFEKFCIHTSFER 235 S+A QIL VELHN F I++ ER Sbjct: 455 SDALKQILSAAYNVELHNS--SPFSIYSFLER 484 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 23.0 bits (47), Expect = 1.9 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = -3 Query: 330 SEANDQILEVR*KVELHNDIFEKFCIHTSFER 235 S+A QIL VELHN F I++ ER Sbjct: 493 SDALKQILSAAYNVELHNS--SPFSIYSFLER 522 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 21.0 bits (42), Expect = 7.7 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = -3 Query: 423 LLSRIANFLICIATLIGCLRDQNAELIHSRNS 328 LLS A+ +I AT +D ++H +NS Sbjct: 245 LLSISASCVIAFATSALVSKDSKFNMVHIQNS 276 >AY568009-1|AAS73299.1| 300|Apis mellifera ADP/ATP translocase protein. Length = 300 Score = 21.0 bits (42), Expect = 7.7 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +3 Query: 72 ITSLFRGMIVLKQAFAVVRAA 134 IT L+RG V Q + RAA Sbjct: 172 ITGLYRGFGVSVQGIIIYRAA 192 >AY332626-1|AAQ24500.1| 300|Apis mellifera ADP/ATP translocase protein. Length = 300 Score = 21.0 bits (42), Expect = 7.7 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +3 Query: 72 ITSLFRGMIVLKQAFAVVRAA 134 IT L+RG V Q + RAA Sbjct: 172 ITGLYRGFGVSVQGIIIYRAA 192 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 130,282 Number of Sequences: 438 Number of extensions: 2426 Number of successful extensions: 11 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -