BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS311A08f (449 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. 22 3.1 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 21 5.4 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 21 7.1 >U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. Length = 470 Score = 21.8 bits (44), Expect = 3.1 Identities = 10/26 (38%), Positives = 16/26 (61%), Gaps = 2/26 (7%) Frame = +2 Query: 257 YALPYTVVSIPHHL*YQI--PTSQDI 328 Y+ PY +++ PH YQI P + +I Sbjct: 428 YSGPYKIIAKPHPNTYQIADPVTNEI 453 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 21.0 bits (42), Expect = 5.4 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +3 Query: 213 FNRIGGVQQHVFTE 254 FN + VQQH F + Sbjct: 101 FNSVRNVQQHTFAD 114 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 20.6 bits (41), Expect = 7.1 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +3 Query: 282 QYPIIYDIRSRPRKISSPTGSKDLQMVNIS 371 +YP+I +R R IS +KD+ I+ Sbjct: 444 KYPLIGAMREELRGISRGKNAKDVDWQKIA 473 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 110,041 Number of Sequences: 336 Number of extensions: 2236 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10195961 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -