BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS310H12f (331 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g50760.1 68416.m05558 glycosyl transferase family 8 protein c... 25 9.3 At2g44990.1 68415.m05602 dioxygenase-related low similarity to c... 25 9.3 >At3g50760.1 68416.m05558 glycosyl transferase family 8 protein contains Pfam profile: PF01501 Glycosyl transferase family 8 Length = 285 Score = 25.4 bits (53), Expect = 9.3 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = -2 Query: 315 SEYSYLQYH*CPIDFSVISGLLSSS 241 + + YL++ P D + ISGL+S+S Sbjct: 47 ASFPYLKFRIYPYDVAAISGLISTS 71 >At2g44990.1 68415.m05602 dioxygenase-related low similarity to carotenoid cleavage dioxygenase 1 [Arabidopsis thaliana] GI:3096910; contains Pfam profile PF03055: Retinal pigment epithelial membrane protein Length = 618 Score = 25.4 bits (53), Expect = 9.3 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = -2 Query: 282 PIDFSVISGLLSSSNKYNNRNDGKAMKINVKA 187 P++ S L+ S N Y R D +KI ++A Sbjct: 387 PVEVSSQLWLIHSGNAYETREDNGDLKIQIQA 418 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,403,741 Number of Sequences: 28952 Number of extensions: 31235 Number of successful extensions: 60 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 60 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 60 length of database: 12,070,560 effective HSP length: 71 effective length of database: 10,014,968 effective search space used: 380568784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -