BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS310H09f (309 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15432| Best HMM Match : Ribosomal_L10 (HMM E-Value=3.1e-37) 92 1e-19 SB_27584| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 29 0.77 SB_55989| Best HMM Match : zf-C2H2 (HMM E-Value=8e-08) 28 1.8 SB_11480| Best HMM Match : LCCL (HMM E-Value=7.5) 27 2.4 SB_36524| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.1 SB_6695| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.1 SB_40918| Best HMM Match : DMAP_binding (HMM E-Value=0.48) 27 4.1 SB_56829| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.2 SB_14859| Best HMM Match : SEA (HMM E-Value=0.01) 26 7.2 SB_33607| Best HMM Match : 7tm_1 (HMM E-Value=1.1e-06) 26 7.2 SB_15230| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.2 SB_4861| Best HMM Match : Exonuc_X-T (HMM E-Value=0.0063) 26 7.2 SB_4823| Best HMM Match : HTH_1 (HMM E-Value=4.5e-18) 26 7.2 SB_891| Best HMM Match : DUF1098 (HMM E-Value=0.47) 26 7.2 SB_17030| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 >SB_15432| Best HMM Match : Ribosomal_L10 (HMM E-Value=3.1e-37) Length = 261 Score = 91.9 bits (218), Expect = 1e-19 Identities = 43/58 (74%), Positives = 48/58 (82%) Frame = +2 Query: 98 QLLDEYPKCFIVGADNVGSQQMQQIRISLRGSSIVLMGKNTMMRKAIKDHLDNNPALE 271 Q LDEYPK F+VG DNVGS+QMQ IR SLRG VLMGKNTM+RKAI+ HL+NNP LE Sbjct: 1 QYLDEYPKLFLVGVDNVGSKQMQTIRQSLRGQGEVLMGKNTMIRKAIRGHLENNPDLE 58 >SB_27584| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 7381 Score = 29.1 bits (62), Expect = 0.77 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Frame = +1 Query: 112 VPKMFHRGCR*RGLATDAADPYLAT-WLQYRAHGKKHYDA 228 VPKMFH RG+ T+A P + T +L+ R G++ +A Sbjct: 3856 VPKMFHGNRDNRGIKTNAIFPTIITRYLRIRPMGRRGLNA 3895 >SB_55989| Best HMM Match : zf-C2H2 (HMM E-Value=8e-08) Length = 1011 Score = 27.9 bits (59), Expect = 1.8 Identities = 13/48 (27%), Positives = 22/48 (45%) Frame = +1 Query: 157 TDAADPYLATWLQYRAHGKKHYDAQSHQRPPGQQSSPRGGARYPIRPI 300 T A+P L + +++ G+ DA P +SP + P +PI Sbjct: 482 TTGANPKLDAYQRWKLSGRVEMDATPEVSPKKTDTSPTSQSENPTKPI 529 >SB_11480| Best HMM Match : LCCL (HMM E-Value=7.5) Length = 152 Score = 27.5 bits (58), Expect = 2.4 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +2 Query: 167 QIRISLRGSSIVLMGKNTMMRKAIKDHLDNNP 262 Q+R L S +L+G NT+++ A+ D L P Sbjct: 23 QVRPGLTALSTILLGANTVIQAALPDILAKTP 54 >SB_36524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 26.6 bits (56), Expect = 4.1 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +2 Query: 212 KNTMMRKAIKDHLDNNPALEGGP 280 K T++RK +K HLDN P L P Sbjct: 168 KVTIVRKELKSHLDNLPDLSKLP 190 >SB_6695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 333 Score = 26.6 bits (56), Expect = 4.1 Identities = 19/59 (32%), Positives = 26/59 (44%), Gaps = 3/59 (5%) Frame = +1 Query: 97 PTLGRVPKMFHRGCR*RGLATDAADPYLATWLQYRAH---GKKHYDAQSHQRPPGQQSS 264 P R+ KMF G + RG++ D + T H KK QS Q+ G +SS Sbjct: 154 PDYSRLRKMFQNGLKKRGVSDDGRSVHF-TSPPANGHDDDSKKKKTVQSKQKAKGTKSS 211 >SB_40918| Best HMM Match : DMAP_binding (HMM E-Value=0.48) Length = 366 Score = 26.6 bits (56), Expect = 4.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = -2 Query: 284 YRAPPRGLDCCPG 246 YRAPPRG C PG Sbjct: 18 YRAPPRGRRCNPG 30 >SB_56829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 246 Score = 25.8 bits (54), Expect = 7.2 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 202 AHGKKHYDAQSHQRPPGQQSSPRGGARYPI 291 A HY+ + RP Q+S PRGG +P+ Sbjct: 216 AQSSVHYNYPA-MRPQPQRSMPRGGRPWPM 244 >SB_14859| Best HMM Match : SEA (HMM E-Value=0.01) Length = 1776 Score = 25.8 bits (54), Expect = 7.2 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = +2 Query: 143 NVGSQQMQQIRISLRGSSIVLMGKNTMMRKAIK 241 +VGS + QQ+R + SS V G+N +RK ++ Sbjct: 1257 HVGSGRNQQVRQPVEVSSHVGSGRNQQVRKHVE 1289 Score = 25.4 bits (53), Expect = 9.5 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +2 Query: 137 ADNVGSQQMQQIRISLRGSSIVLMGKNTMMRKAIK 241 + +VGS + QQ+R + SS V G+N +R +K Sbjct: 1309 SSHVGSGRNQQVRKHVEVSSHVGSGRNQQVRHPLK 1343 >SB_33607| Best HMM Match : 7tm_1 (HMM E-Value=1.1e-06) Length = 256 Score = 25.8 bits (54), Expect = 7.2 Identities = 12/47 (25%), Positives = 18/47 (38%) Frame = +3 Query: 129 SWVPITWARNRCSRSVSRYVAPVSCSWEKTL*CAKPSKTTWTTIQPS 269 +W+ W R RC S R + P S + P W +P+ Sbjct: 197 AWLAFAWKRYRCHGSQVRLIKPPSTIVDGRSRAHAPFINYWPLFEPT 243 >SB_15230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 25.8 bits (54), Expect = 7.2 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 4/21 (19%) Frame = +1 Query: 241 RPPGQQS----SPRGGARYPI 291 RPPG Q+ PRGGARY + Sbjct: 32 RPPGDQAYRYRRPRGGARYQL 52 >SB_4861| Best HMM Match : Exonuc_X-T (HMM E-Value=0.0063) Length = 773 Score = 25.8 bits (54), Expect = 7.2 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = -3 Query: 94 DLNEVVRLPSSLVLPTHPG*CG 29 DL+ +++ ++L LP HPG CG Sbjct: 99 DLSVALQVCTNLGLPLHPGKCG 120 >SB_4823| Best HMM Match : HTH_1 (HMM E-Value=4.5e-18) Length = 419 Score = 25.8 bits (54), Expect = 7.2 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = +1 Query: 169 DPYLATWLQYRAHGKKHYDAQSHQRPPGQQSSPRGGARYPIRPIV 303 DP + ++ A KH+ AQ H+ QQS GG+ R ++ Sbjct: 282 DPTRELYSEFNAAFNKHWQAQGHEAITIQQS--HGGSGKQARAVI 324 >SB_891| Best HMM Match : DUF1098 (HMM E-Value=0.47) Length = 715 Score = 25.8 bits (54), Expect = 7.2 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +1 Query: 205 HGKKHYDAQSHQRPPGQQSSPRGG 276 +G A SH PP QQS+P G Sbjct: 171 YGLNQESAASHPCPPSQQSAPAPG 194 >SB_17030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 25.4 bits (53), Expect = 9.5 Identities = 24/80 (30%), Positives = 36/80 (45%) Frame = +2 Query: 2 VLKFHRSPYATLSRMGREDKATWKSNYFVKIIQLLDEYPKCFIVGADNVGSQQMQQIRIS 181 V F +P+ T D A+W Y+V I L P IV V + ++++ RI Sbjct: 169 VTTFRPAPHVTYCTEFWRD-ASWGVLYWVAIFILQYLVPLIIIVSQAAVIAVKLRKSRIP 227 Query: 182 LRGSSIVLMGKNTMMRKAIK 241 + SS + K T +R IK Sbjct: 228 MLSSSSETLYKKT-LRTRIK 246 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,148,496 Number of Sequences: 59808 Number of extensions: 214803 Number of successful extensions: 775 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 732 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 774 length of database: 16,821,457 effective HSP length: 71 effective length of database: 12,575,089 effective search space used: 389827759 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -