BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS310G08f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) 33 0.14 SB_57159| Best HMM Match : PI-PLC-X (HMM E-Value=0) 29 3.1 >SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) Length = 4160 Score = 33.1 bits (72), Expect = 0.14 Identities = 17/34 (50%), Positives = 23/34 (67%) Frame = -3 Query: 204 SNKTTKANELRLLKSQFKVYTHSSYMDVKENLRK 103 S K + ELR++KSQ + Y H SYMDV NL++ Sbjct: 1649 SLKRKLSGELRVVKSQAEEY-HKSYMDVNRNLQE 1681 >SB_57159| Best HMM Match : PI-PLC-X (HMM E-Value=0) Length = 1289 Score = 28.7 bits (61), Expect = 3.1 Identities = 13/48 (27%), Positives = 25/48 (52%) Frame = -3 Query: 222 VLSSNYSNKTTKANELRLLKSQFKVYTHSSYMDVKENLRKVLFRTITL 79 V++S++ +KTT +N L L+ + T S L+ + T+T+ Sbjct: 552 VIASDFHSKTTSSNRLSLISNSSSTSTESDLSSGASELQSIHTPTVTV 599 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,145,127 Number of Sequences: 59808 Number of extensions: 210189 Number of successful extensions: 384 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 336 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 384 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -