BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS310G05f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 25 1.5 AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CY... 25 2.0 AF487535-1|AAL93296.1| 494|Anopheles gambiae cytochrome P450 CY... 25 2.0 AJ010195-1|CAA09034.1| 687|Anopheles gambiae prophenoloxidase p... 23 8.2 AF004915-1|AAB94671.1| 688|Anopheles gambiae pro-phenol oxidase... 23 8.2 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 25.0 bits (52), Expect = 1.5 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = -1 Query: 491 DPTHRPELQREASSYANQRRDALSLKPFPRDIRSRNQAH 375 DPT + +Q + YA +R SL P+ + ++Q H Sbjct: 64 DPTPQQYIQTDQYQYAQPQRQHPSLVAGPQQQQQQHQQH 102 >AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CYP6Z2 protein protein. Length = 490 Score = 24.6 bits (51), Expect = 2.0 Identities = 9/22 (40%), Positives = 16/22 (72%) Frame = -2 Query: 193 PVLAVSLNTATFKLPKLYTQQR 128 P+L++S+N F P+LY+ +R Sbjct: 394 PLLSISMNEKYFPDPELYSPER 415 >AF487535-1|AAL93296.1| 494|Anopheles gambiae cytochrome P450 CYP6Z1 protein. Length = 494 Score = 24.6 bits (51), Expect = 2.0 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = -2 Query: 193 PVLAVSLNTATFKLPKLYTQQR 128 P+L +S+N F P+LY+ +R Sbjct: 394 PLLGISMNEKYFPEPELYSPER 415 >AJ010195-1|CAA09034.1| 687|Anopheles gambiae prophenoloxidase protein. Length = 687 Score = 22.6 bits (46), Expect = 8.2 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -1 Query: 497 YCDPTHRPELQREASSYANQRRDALSL 417 + DPT P+L RE + N +RD +++ Sbjct: 154 FVDPTVIPKL-REEGAVVNNQRDRITI 179 >AF004915-1|AAB94671.1| 688|Anopheles gambiae pro-phenol oxidase subunit 1 protein. Length = 688 Score = 22.6 bits (46), Expect = 8.2 Identities = 8/30 (26%), Positives = 16/30 (53%) Frame = -1 Query: 500 QYCDPTHRPELQREASSYANQRRDALSLKP 411 Q+ DP P+L+ E ++ + R + + P Sbjct: 153 QFVDPAVFPKLREEGAAVQQENRMVIDIPP 182 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 471,343 Number of Sequences: 2352 Number of extensions: 8365 Number of successful extensions: 16 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -