BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS310G04f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_01_0057 + 476172-476283,476337-476449,476532-476634,477089-47... 29 3.0 12_02_0800 + 23299674-23299678,23299714-23299791,23299876-232999... 27 9.1 11_06_0695 - 26340161-26340804,26342057-26343429,26344074-263441... 27 9.1 >03_01_0057 + 476172-476283,476337-476449,476532-476634,477089-477210, 477303-477497,477627-477701,478082-478179,478328-478421 Length = 303 Score = 28.7 bits (61), Expect = 3.0 Identities = 12/41 (29%), Positives = 20/41 (48%) Frame = -2 Query: 349 LFFYTVDRAVNYTKRSKSKNLKSAHSKQILV*QRRFEENVW 227 LFF +V + KR K ++ H + +++ R F VW Sbjct: 259 LFFELFTASVCFGKRIKHSSISEGHDENLVIDNREFPFKVW 299 >12_02_0800 + 23299674-23299678,23299714-23299791,23299876-23299920, 23300052-23300415,23300493-23300574,23300793-23300873, 23300974-23302106,23302202-23302350,23302426-23302516, 23303628-23305940 Length = 1446 Score = 27.1 bits (57), Expect = 9.1 Identities = 15/42 (35%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = -2 Query: 316 YTKRSKSKNLKSAHSKQILV*QRRFEEN-VWEIKVVENSCGA 194 Y + SK L+ + +QIL ++ EEN + + ++VE S GA Sbjct: 1060 YVPKPLSKELQQQNLRQILPSEKSCEENKIRDKEIVERSTGA 1101 >11_06_0695 - 26340161-26340804,26342057-26343429,26344074-26344173, 26345230-26345362,26346857-26347258 Length = 883 Score = 27.1 bits (57), Expect = 9.1 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = +2 Query: 410 HNFIRKCFYSLITNRVFAHSRFCFDSH 490 HN I YS++ N F H R C H Sbjct: 165 HNGIPSVLYSVLANEEFDHERECEHKH 191 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,080,195 Number of Sequences: 37544 Number of extensions: 202526 Number of successful extensions: 312 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 312 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 312 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -