BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS310G04f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_2413| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.76 SB_46949| Best HMM Match : DUF77 (HMM E-Value=5.5) 28 5.4 SB_48142| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 >SB_2413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 493 Score = 30.7 bits (66), Expect = 0.76 Identities = 13/40 (32%), Positives = 26/40 (65%), Gaps = 1/40 (2%) Frame = -2 Query: 355 ITLFFYT-VDRAVNYTKRSKSKNLKSAHSKQILV*QRRFE 239 + +F T V++A NYT+ +K L +AH K+ + +++F+ Sbjct: 4 LEIFMQTLVEKACNYTQARNAKTLSTAHLKRCITSEQQFD 43 >SB_46949| Best HMM Match : DUF77 (HMM E-Value=5.5) Length = 160 Score = 27.9 bits (59), Expect = 5.4 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -3 Query: 84 PVSEVWWRQSQSDVYDFNHTKL 19 PV WW + ++D DFN T++ Sbjct: 54 PVGNEWWEKRKNDDKDFNSTRV 75 >SB_48142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 27.9 bits (59), Expect = 5.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -1 Query: 86 DLCLKFGGDNHKAMSTTL 33 D CL GGDNHKA TL Sbjct: 62 DHCLACGGDNHKARFCTL 79 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,580,196 Number of Sequences: 59808 Number of extensions: 256742 Number of successful extensions: 498 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 459 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 498 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -