BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS310G04f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY928182-1|AAX22219.1| 335|Anopheles gambiae phenoloxidase inhi... 25 1.2 AB090824-1|BAC57923.1| 298|Anopheles gambiae gag-like protein p... 23 4.7 DQ314781-1|ABC54566.1| 407|Anopheles gambiae OSKAR protein. 23 8.2 >AY928182-1|AAX22219.1| 335|Anopheles gambiae phenoloxidase inhibitor protein protein. Length = 335 Score = 25.4 bits (53), Expect = 1.2 Identities = 21/86 (24%), Positives = 36/86 (41%), Gaps = 2/86 (2%) Frame = -2 Query: 520 SSTHVFKYHFVAVKAKSAMCKNSICNQRVKTFSYKIVNFY-IK*NL*INIKATHRHIT-L 347 ++TH A + + + C++ +F+YK VN Y + N+ T + + Sbjct: 157 TTTHTSVPKMCAKIGEYCLTSSECCSKSCLSFAYKCVNRYDLSVVADPNLPVTSTYTSNR 216 Query: 346 FFYTVDRAVNYTKRSKSKNLKSAHSK 269 F TVD T + S L H+K Sbjct: 217 FGGTVDETSTGTPKCTSNGLYCVHNK 242 >AB090824-1|BAC57923.1| 298|Anopheles gambiae gag-like protein protein. Length = 298 Score = 23.4 bits (48), Expect = 4.7 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -1 Query: 83 LCLKFGGDNHKAMSTT 36 LC++ G NHKA++ T Sbjct: 257 LCIRCGAANHKAVNCT 272 >DQ314781-1|ABC54566.1| 407|Anopheles gambiae OSKAR protein. Length = 407 Score = 22.6 bits (46), Expect = 8.2 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -3 Query: 66 WRQSQSDVYDFN 31 WRQS+SD DF+ Sbjct: 196 WRQSRSDELDFS 207 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 496,483 Number of Sequences: 2352 Number of extensions: 8915 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -