BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS310F12f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 24 0.71 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 23 1.2 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 23 1.2 AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 23 1.2 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 23 1.2 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 24.2 bits (50), Expect = 0.71 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -1 Query: 122 KFNIYCHLLINIYCHLFVIL 63 K N YC+ +I Y +FVIL Sbjct: 317 KTNKYCNFIILFYLSVFVIL 336 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 23.4 bits (48), Expect = 1.2 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +1 Query: 424 PLHRPIRNFVPKTPHRIN 477 P H+P RN V PH IN Sbjct: 741 PHHQPPRNPVGTNPHDIN 758 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 23.4 bits (48), Expect = 1.2 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +1 Query: 424 PLHRPIRNFVPKTPHRIN 477 P H+P RN V PH IN Sbjct: 633 PHHQPPRNPVGTNPHDIN 650 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 23.4 bits (48), Expect = 1.2 Identities = 8/32 (25%), Positives = 20/32 (62%) Frame = +2 Query: 176 VYIFYYDFFIDKKKTTKLSNFIHNDL*KKYKN 271 +Y+F ++++KK T +L F + + ++ +N Sbjct: 231 IYVFNPRYYLEKKVTRRLHRFTKSVIAERQEN 262 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 23.4 bits (48), Expect = 1.2 Identities = 8/32 (25%), Positives = 20/32 (62%) Frame = +2 Query: 176 VYIFYYDFFIDKKKTTKLSNFIHNDL*KKYKN 271 +Y+F ++++KK T +L F + + ++ +N Sbjct: 231 IYVFNPRYYLEKKVTRRLHRFTKSVIAERQEN 262 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 109,761 Number of Sequences: 336 Number of extensions: 2367 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -