BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS310F07f (521 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g20200.1 68417.m02953 terpene synthase/cyclase family protein... 27 7.7 >At4g20200.1 68417.m02953 terpene synthase/cyclase family protein 5-epi-aristolochene synthase, Nicotiana tabacum, PATX:G505588 Length = 604 Score = 27.1 bits (57), Expect = 7.7 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -3 Query: 420 PKIKTQLNI*TEVKLRPATKLETIHLSNRPPFPQKEI 310 PK+ +Q+ + + L P +KL HL++ P P K I Sbjct: 9 PKLGSQIFLSSSTNLWPLSKLYGFHLTSFPSKPLKHI 45 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,285,151 Number of Sequences: 28952 Number of extensions: 197430 Number of successful extensions: 352 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 348 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 351 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 957410176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -