BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS310F01f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 21 5.0 AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory recept... 21 8.7 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 21.4 bits (43), Expect = 5.0 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = -1 Query: 470 KSLIKISKICLQCIKNKNL*TIRAASTNFTDTILTRI 360 K + +I LQC ++N+ +TN+ T L R+ Sbjct: 782 KQVYRIGSNGLQCYIDRNVVFSSQNNTNWVPTSLNRL 818 >AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory receptor candidate 40 protein. Length = 373 Score = 20.6 bits (41), Expect = 8.7 Identities = 7/26 (26%), Positives = 14/26 (53%) Frame = -2 Query: 151 HTLLVYFPHNVIIIVGLSDNNSFPVS 74 H + Y P+N++ + L+ PV+ Sbjct: 188 HYIFTYMPYNIVFGLCLTTFGLLPVN 213 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 109,501 Number of Sequences: 336 Number of extensions: 2113 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -