BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS310E08f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_14450| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00024) 28 4.1 SB_26174| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_20936| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 >SB_14450| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00024) Length = 290 Score = 28.3 bits (60), Expect = 4.1 Identities = 12/42 (28%), Positives = 22/42 (52%) Frame = +1 Query: 1 SGAEKHYTKVYNQDQVSIMFPVASGMPFIFKYKEPAVIHFQS 126 + +++ Y VY D VS++ P +EP ++HF+S Sbjct: 100 TSSKEQYAYVYRSDLVSVVSKYVYSDPKDLFEREPFIVHFRS 141 >SB_26174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 885 Score = 27.9 bits (59), Expect = 5.4 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = -1 Query: 359 GSTLNFISPDLISIPNLNGMLNWSLFTTPTLEYWLLRVSIKPT 231 G + + DL+ IP+ + M SL T+ + + W R S KPT Sbjct: 111 GKPQGYFAEDLVPIPSQSNMPQGSLSTSRSHDCW-KRTSSKPT 152 >SB_20936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 27.5 bits (58), Expect = 7.1 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +1 Query: 415 ASQKKDSLVAISQDPATKIVERRSKVFSVDSKYGQ 519 A Q+K LVA+ D KI+E++S SK+ Q Sbjct: 86 APQEKAFLVAVMNDARQKIIEQKSPTKKKSSKFLQ 120 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,895,605 Number of Sequences: 59808 Number of extensions: 320310 Number of successful extensions: 710 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 676 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 710 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -