BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS310E08f (521 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE013599-1080|AAF58803.1| 593|Drosophila melanogaster CG12900-P... 30 2.2 AE014297-2636|AAF55643.2| 426|Drosophila melanogaster CG5558-PB... 28 8.8 >AE013599-1080|AAF58803.1| 593|Drosophila melanogaster CG12900-PA protein. Length = 593 Score = 29.9 bits (64), Expect = 2.2 Identities = 18/73 (24%), Positives = 34/73 (46%), Gaps = 1/73 (1%) Frame = -3 Query: 489 LASTFD-NFSSWVLRDCNKGILLLAGTVRPNTIVN*GLILVWMQRFDSELY*SRFNFDSE 313 L + F+ +F + V + LLL+ + I++W+Q SE + R F + Sbjct: 75 LVNNFNKDFLALVYMESEADTLLLSALAADLNHIRDARIMIWLQMSPSENFLDRIVFQAS 134 Query: 312 FERYVKLEFIHNT 274 ++++ L I NT Sbjct: 135 KQKFLNLVVIENT 147 >AE014297-2636|AAF55643.2| 426|Drosophila melanogaster CG5558-PB, isoform B protein. Length = 426 Score = 27.9 bits (59), Expect = 8.8 Identities = 12/34 (35%), Positives = 22/34 (64%) Frame = -1 Query: 287 LFTTPTLEYWLLRVSIKPTFPSIFLAYVNCTSLI 186 +FT P L ++ +R ++ +FP + L VNC S++ Sbjct: 53 MFTLPFLGFYGVRSWLQESFPHLDLFTVNCWSVL 86 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,628,364 Number of Sequences: 53049 Number of extensions: 460314 Number of successful extensions: 1117 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1085 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1117 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 1929233664 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -