BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS310E02f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 26 0.20 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 24 1.1 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 21 5.8 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 7.7 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 21 7.7 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 26.2 bits (55), Expect = 0.20 Identities = 17/57 (29%), Positives = 30/57 (52%) Frame = +1 Query: 88 QDLEEKLYNSILTGDYDSAVRQSLEYESQGKGSIIQNVVNNLIIDKRRNTMEYCYKL 258 ++ E+++ ++IL G YD+ +R S E + G + N+ I TMEY +L Sbjct: 29 REKEKEVLDNIL-GGYDARIRPSGENATDGPAVVRVNIFVRSISKIDDVTMEYSVQL 84 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 23.8 bits (49), Expect = 1.1 Identities = 16/57 (28%), Positives = 29/57 (50%) Frame = +1 Query: 88 QDLEEKLYNSILTGDYDSAVRQSLEYESQGKGSIIQNVVNNLIIDKRRNTMEYCYKL 258 ++ E+++ ++IL G YD+ +R S E + G + N+ I MEY +L Sbjct: 29 REKEKEVLDNIL-GGYDARIRPSGENATDGPAIVRVNLFVRSIATISDIKMEYSVQL 84 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 21.4 bits (43), Expect = 5.8 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = -1 Query: 74 ADSSTTPALAASMHIANTTRSFI 6 A+ + +A +HI+N T SF+ Sbjct: 396 ANKMESSGMAGRVHISNATLSFL 418 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.0 bits (42), Expect = 7.7 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +1 Query: 418 DGVDKHTELVSWK 456 D +D+HT V+WK Sbjct: 986 DDLDQHTLKVTWK 998 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 21.0 bits (42), Expect = 7.7 Identities = 8/26 (30%), Positives = 12/26 (46%) Frame = -1 Query: 245 YSMVFRLLSMIRLLTTFWMMEPLPWL 168 Y+M F T F ++P PW+ Sbjct: 213 YNMTFAQNGPFNTTTIFVPVKPCPWI 238 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 151,613 Number of Sequences: 438 Number of extensions: 3272 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -