BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS310D12f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0652 - 18424489-18424525,18424639-18424702,18424796-184248... 27 9.1 >04_03_0652 - 18424489-18424525,18424639-18424702,18424796-18424869, 18425809-18425924,18426078-18426343,18427659-18427749 Length = 215 Score = 27.1 bits (57), Expect = 9.1 Identities = 15/48 (31%), Positives = 21/48 (43%) Frame = -2 Query: 157 NYDFNYNRIYKHVAVILKIYGYISNLCYFKIFLYLMLDLMNNKYLNSP 14 N+ + Y +V I I G++ L Y F Y + L NN L P Sbjct: 167 NWAYRYFTEPHYVHWITWISGFVQTLLYADFFYYYLNSLKNNVKLTLP 214 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,497,494 Number of Sequences: 37544 Number of extensions: 169854 Number of successful extensions: 267 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 265 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 267 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -