BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS310D11f (493 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q5CPS7 Cluster: Putative uncharacterized protein; n=2; ... 36 0.65 UniRef50_A0RZ99 Cluster: Putative uncharacterized protein; n=1; ... 33 3.5 >UniRef50_Q5CPS7 Cluster: Putative uncharacterized protein; n=2; Cryptosporidium|Rep: Putative uncharacterized protein - Cryptosporidium parvum Iowa II Length = 784 Score = 35.5 bits (78), Expect = 0.65 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +3 Query: 177 YIIYTHI-RIL*NLNKKERNHLFAKHNENELLHKLKAASMLCHY 305 Y+ Y I RIL N+ ER+HLF KHN N L + S +Y Sbjct: 408 YLQYKRITRILLNIYNSERSHLFEKHNSNNNLSSINFKSNYDNY 451 >UniRef50_A0RZ99 Cluster: Putative uncharacterized protein; n=1; Cenarchaeum symbiosum|Rep: Putative uncharacterized protein - Cenarchaeum symbiosum Length = 742 Score = 33.1 bits (72), Expect = 3.5 Identities = 18/50 (36%), Positives = 28/50 (56%) Frame = -2 Query: 342 HNILHCTKIRMSNNDKAYSLLLTYVITHFHYA*RINDFFLSCLNFTRSEC 193 ++ILH KI+ S DK+YSL+ ++ Y I + LSC+ R +C Sbjct: 253 NDILH--KIKRSIEDKSYSLINISLLDDDFYFNYIREVMLSCVRHDRDQC 300 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 404,260,070 Number of Sequences: 1657284 Number of extensions: 6756304 Number of successful extensions: 10884 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 10648 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10883 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 28437262108 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -