BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS310D11f (493 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL832599-1|CAD89942.1| 97|Homo sapiens hypothetical protein pr... 29 6.6 AK054566-1|BAB70759.1| 205|Homo sapiens protein ( Homo sapiens ... 29 6.6 AF480299-1|AAL87129.1| 205|Homo sapiens StAR-related lipid tran... 29 6.6 >AL832599-1|CAD89942.1| 97|Homo sapiens hypothetical protein protein. Length = 97 Score = 29.5 bits (63), Expect = 6.6 Identities = 14/30 (46%), Positives = 21/30 (70%), Gaps = 3/30 (10%) Frame = +3 Query: 96 DNPAESYLTGYVQTGYRRI---SVLDTSIS 176 DNP +S LTGY+QT R + S +DT+++ Sbjct: 54 DNPNQSLLTGYIQTDLRGMIPQSAVDTAMA 83 >AK054566-1|BAB70759.1| 205|Homo sapiens protein ( Homo sapiens cDNA FLJ30004 fis, clone 3NB691000116, weakly similar to STEROIDOGENIC ACUTE REGULATORY PROTEIN PRECURSOR. ). Length = 205 Score = 29.5 bits (63), Expect = 6.6 Identities = 14/30 (46%), Positives = 21/30 (70%), Gaps = 3/30 (10%) Frame = +3 Query: 96 DNPAESYLTGYVQTGYRRI---SVLDTSIS 176 DNP +S LTGY+QT R + S +DT+++ Sbjct: 162 DNPNQSLLTGYIQTDLRGMIPQSAVDTAMA 191 >AF480299-1|AAL87129.1| 205|Homo sapiens StAR-related lipid transfer protein 4 protein. Length = 205 Score = 29.5 bits (63), Expect = 6.6 Identities = 14/30 (46%), Positives = 21/30 (70%), Gaps = 3/30 (10%) Frame = +3 Query: 96 DNPAESYLTGYVQTGYRRI---SVLDTSIS 176 DNP +S LTGY+QT R + S +DT+++ Sbjct: 162 DNPNQSLLTGYIQTDLRGMIPQSAVDTAMA 191 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 58,463,951 Number of Sequences: 237096 Number of extensions: 1044258 Number of successful extensions: 9588 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9572 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9588 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4423060356 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -