BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS310D10f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_14227| Best HMM Match : Cofilin_ADF (HMM E-Value=0.0013) 35 0.035 SB_11461| Best HMM Match : NHL (HMM E-Value=0) 30 1.3 SB_57888| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_37259| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_27848| Best HMM Match : zf-C2H2 (HMM E-Value=1.49995e-41) 29 3.1 SB_8814| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_39636| Best HMM Match : WSC (HMM E-Value=0.34) 29 3.1 SB_12584| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_44857| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_25705| Best HMM Match : PH (HMM E-Value=2e-17) 28 5.4 SB_43377| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_51372| Best HMM Match : Pyr_redox (HMM E-Value=3e-12) 27 7.1 SB_31695| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_56393| Best HMM Match : CTF_NFI (HMM E-Value=0.75) 27 9.4 SB_35197| Best HMM Match : SAP (HMM E-Value=3.2) 27 9.4 SB_35002| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_35345| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_24994| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 >SB_14227| Best HMM Match : Cofilin_ADF (HMM E-Value=0.0013) Length = 310 Score = 35.1 bits (77), Expect = 0.035 Identities = 14/32 (43%), Positives = 24/32 (75%) Frame = -2 Query: 505 VKKKMLYSSSFDALKKSLVGVQKYIQATDLSE 410 +KKKML S+++ LKK G++KY +A+++ E Sbjct: 267 IKKKMLAGSTWEYLKKKFDGLKKYFEASEICE 298 >SB_11461| Best HMM Match : NHL (HMM E-Value=0) Length = 819 Score = 29.9 bits (64), Expect = 1.3 Identities = 19/45 (42%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = -2 Query: 349 THELA--TKPNPLSDTPALTTRGHDTTSRLVLLQRKTNSINMIDF 221 T EL+ T+ NPL TPAL++RG T R+ + + N+ IDF Sbjct: 296 TQELSDTTRLNPL--TPALSSRGQRGTPRIPYRESQQNAEGNIDF 338 >SB_57888| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 565 Score = 29.1 bits (62), Expect = 2.3 Identities = 13/43 (30%), Positives = 20/43 (46%), Gaps = 2/43 (4%) Frame = +1 Query: 94 CHPYSY--NGCPALQTETHYCFTAEIGRGRWYLPARTHKRSYH 216 CHP N C +T+ + C + + WY P++T YH Sbjct: 437 CHPTKTQANWCHPTKTQANLCHPTKT-QANWYHPSKTQANWYH 478 >SB_37259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1690 Score = 28.7 bits (61), Expect = 3.1 Identities = 17/48 (35%), Positives = 26/48 (54%) Frame = -2 Query: 472 DALKKSLVGVQKYIQATDLSEASQEAVEEKLRATDRQ*TAFTHELATK 329 D LKK + +QK +L +AS E EEK + + + F H++A K Sbjct: 403 DGLKKRMEQIQK-----ELQQASSELEEEKKKTENLLSSIFPHDVANK 445 >SB_27848| Best HMM Match : zf-C2H2 (HMM E-Value=1.49995e-41) Length = 257 Score = 28.7 bits (61), Expect = 3.1 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -1 Query: 59 PLNTWWAVSSSNHLSKKKK 3 P+ TW S SNH S KKK Sbjct: 99 PMKTWLRASDSNHKSSKKK 117 >SB_8814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 824 Score = 28.7 bits (61), Expect = 3.1 Identities = 20/61 (32%), Positives = 21/61 (34%), Gaps = 1/61 (1%) Frame = -2 Query: 349 THELATKPNPLSDTPALTTRGHDTTSRLVLLQRKT-NSINMIDFTGGRTSCESARVGTTA 173 THE L DT T HDTT L T N + D TG T T Sbjct: 515 THETTRHDTHLHDTTENDTHPHDTTGNDTYLHDTTENDTHPHDTTGNDTQLHDTTGNKTR 574 Query: 172 P 170 P Sbjct: 575 P 575 >SB_39636| Best HMM Match : WSC (HMM E-Value=0.34) Length = 390 Score = 28.7 bits (61), Expect = 3.1 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = -2 Query: 202 CESARVGTTAPCLFLP*SSNAFRFEGRGSRCNYMGGTFML 83 C+S TT+ C++L NA RC +GGTF L Sbjct: 207 CKSGWHSTTSRCIYL--MPNATYPGSTAERCRLLGGTFFL 244 >SB_12584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 692 Score = 28.3 bits (60), Expect = 4.1 Identities = 17/51 (33%), Positives = 19/51 (37%) Frame = -1 Query: 431 PSDRPLGSVSGGRRREAPRHRSPINSIYTRARDETEPALRHSCPDDTRPRH 279 P DRP + P RS S Y RD A + C D R RH Sbjct: 458 PRDRPRARAHDTDQPSDPCQRSADQSPYPTQRDSQPGAGKRPCSDAGRHRH 508 >SB_44857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 27.9 bits (59), Expect = 5.4 Identities = 15/57 (26%), Positives = 25/57 (43%), Gaps = 3/57 (5%) Frame = +2 Query: 353 CCLLAIGGAELLFDGLLRRFREVGRLDVLLNSDXGLFQS---VERARVQHLLLDLGG 514 CC+L + E L + +GR D + + G F + R +HL+ +GG Sbjct: 85 CCILRMSMTEALAGATINAAASLGRADTHGSLEVGKFADMVVINAERWEHLIYQIGG 141 >SB_25705| Best HMM Match : PH (HMM E-Value=2e-17) Length = 409 Score = 27.9 bits (59), Expect = 5.4 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = -2 Query: 403 QEAVEEKLRATDRQ*TAFTHEL--ATKPNPLSDTPALTTRGH 284 +E K+ AT+ AFTH+L KP +SD P + +G+ Sbjct: 22 EETPPIKIEATNHHAKAFTHDLENLAKPLKVSDVPNVFLQGY 63 >SB_43377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 625 Score = 27.5 bits (58), Expect = 7.1 Identities = 18/41 (43%), Positives = 22/41 (53%) Frame = +2 Query: 347 CKCCLLAIGGAELLFDGLLRRFREVGRLDVLLNSDXGLFQS 469 C CLL G + L DGL RR G ++VLL D G +S Sbjct: 348 CIACLLFGGSRKRLPDGLTRR----GDINVLLLGDPGTAKS 384 >SB_51372| Best HMM Match : Pyr_redox (HMM E-Value=3e-12) Length = 872 Score = 27.5 bits (58), Expect = 7.1 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +3 Query: 108 LQRLPRPSNRNALLLHGRNRQGA 176 +QR P P+ RN++ LHG Q A Sbjct: 30 VQRRPEPTPRNSIFLHGLRAQTA 52 >SB_31695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 320 Score = 27.5 bits (58), Expect = 7.1 Identities = 15/53 (28%), Positives = 25/53 (47%) Frame = -2 Query: 481 SSFDALKKSLVGVQKYIQATDLSEASQEAVEEKLRATDRQ*TAFTHELATKPN 323 SSF A + L+ Y + TD E + ++ + ATD T+ H +P+ Sbjct: 244 SSFTAEIRDLIETSSYTKDTDFDEETSSLLKSQTDATDDTMTSDEHCRTQEPS 296 >SB_56393| Best HMM Match : CTF_NFI (HMM E-Value=0.75) Length = 886 Score = 27.1 bits (57), Expect = 9.4 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -1 Query: 413 GSVSGGRRREAPRHRSPINSIYTRARDETE 324 G V +R +P RS S ++RDETE Sbjct: 62 GQVCNNKREASPNSRSGAGSARKKSRDETE 91 >SB_35197| Best HMM Match : SAP (HMM E-Value=3.2) Length = 323 Score = 27.1 bits (57), Expect = 9.4 Identities = 17/57 (29%), Positives = 26/57 (45%) Frame = +3 Query: 213 PPVKSIILILFVFLCNNTKRLVVSWPRVVRAGVSESGFGFVASSCVNAVYWRSVARS 383 P + II+I+++ + NNT L SW V A + C WR +AR+ Sbjct: 125 PLIIIIIVIIYIIIINNTGILDRSWAGVQTALKPRANCAMTCQHC-----WRILARN 176 >SB_35002| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 907 Score = 27.1 bits (57), Expect = 9.4 Identities = 26/105 (24%), Positives = 43/105 (40%) Frame = +3 Query: 204 EVLPPVKSIILILFVFLCNNTKRLVVSWPRVVRAGVSESGFGFVASSCVNAVYWRSVARS 383 +V PP I+ I +NT L ++ P + R G A S NAV RS+ Sbjct: 400 QVQPPDYPILPISVAGCASNTSALNITMPHIARRGADLLAIRLGARSTGNAV--RSLRGV 457 Query: 384 FSSTAS*DASERSVAWMYF*TPTRDFFRASNELEYNIFFLTLGGV 518 + D S +++ P+ +F +E + +F + GV Sbjct: 458 VRIESLRDRYIYSFRGLFY-WPSHNFIHDGSERVFPLFEFSSRGV 501 >SB_35345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 27.1 bits (57), Expect = 9.4 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -1 Query: 413 GSVSGGRRREAPRHRSPINSIYTRARDETE 324 G V +R +P RS S ++RDETE Sbjct: 67 GQVCNNKREASPNSRSGAGSARKKSRDETE 96 >SB_24994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1122 Score = 27.1 bits (57), Expect = 9.4 Identities = 11/41 (26%), Positives = 22/41 (53%) Frame = +3 Query: 87 INVPPI*LQRLPRPSNRNALLLHGRNRQGAVVPTRADSQEV 209 ++VPP L R RP N L + G + + +P + ++++ Sbjct: 299 LSVPPEQLSRNERPKNTTTLFVSGVDTMASKLPVQRSARDI 339 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,766,123 Number of Sequences: 59808 Number of extensions: 347692 Number of successful extensions: 946 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 853 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 945 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -