BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS310D05f (309 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_53506| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.44 SB_14298| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.1 SB_25230| Best HMM Match : NACHT (HMM E-Value=0.0015) 25 9.5 >SB_53506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 378 Score = 29.9 bits (64), Expect = 0.44 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = -3 Query: 271 VI*NYFSYGFVXFXISSKLQSCVG 200 VI N+ SYG V SSKLQ C+G Sbjct: 178 VIPNHISYGLVLARNSSKLQKCLG 201 >SB_14298| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 427 Score = 26.6 bits (56), Expect = 4.1 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = +2 Query: 140 NFTQQNPFTKVLNKKSVCVRSDARLEFTGYXKXNETIREI 259 ++T Q ++ L +C+R+ +R T + K T+REI Sbjct: 133 HYTVQYLYSTALEHVDICLRNCSRNSRTPFAKFANTVREI 172 >SB_25230| Best HMM Match : NACHT (HMM E-Value=0.0015) Length = 1238 Score = 25.4 bits (53), Expect = 9.5 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 177 IKKVCVSAPTHDWSLLDXKN 236 +KK C SA + +W+L KN Sbjct: 180 VKKTCNSASSREWTLQSVKN 199 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,969,527 Number of Sequences: 59808 Number of extensions: 123999 Number of successful extensions: 193 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 192 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 193 length of database: 16,821,457 effective HSP length: 71 effective length of database: 12,575,089 effective search space used: 389827759 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -