BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS310D01f (521 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC609.02 |ptn1||phosphatidylinositol-3,4,5-trisphosphate3-phos... 30 0.24 SPAC1952.16 |rga9||RhoGAp, GTPase activator towards Rho/Rac/Cdc4... 29 0.56 SPAC29B12.12 |||helper of TIM |Schizosaccharomyces pombe|chr 1||... 28 0.97 SPAC4D7.01c |sec71|sec7a, SPAP8A3.15c|Sec7 domain|Schizosaccharo... 27 1.3 SPCC16C4.06c |||tRNA pseudouridylate synthase |Schizosaccharomyc... 27 1.7 SPBP8B7.12c |fta3|sma3|Sim4 and Mal2 associated |Schizosaccharom... 26 3.0 SPAC1006.09 |win1|SPAC1250.06c, SPAPJ730.01|MAP kinase kinase ki... 26 3.9 SPAC3H8.04 |||chromosome segregation protein|Schizosaccharomyces... 25 9.0 >SPBC609.02 |ptn1||phosphatidylinositol-3,4, 5-trisphosphate3-phosphatase|Schizosaccharomyces pombe|chr 2|||Manual Length = 348 Score = 29.9 bits (64), Expect = 0.24 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = -2 Query: 259 GVHRLFSSDELELLTTPTVLRFSNWATLLSKVSRIRRETYFHMITFK 119 G+H+L+ +DEL++ T NW L + ET +H+ FK Sbjct: 45 GIHKLYRNDELDVFKYLTTQLKDNWILL----NLCAEETVYHLELFK 87 >SPAC1952.16 |rga9||RhoGAp, GTPase activator towards Rho/Rac/Cdc42-like small GTPases|Schizosaccharomyces pombe|chr 1|||Manual Length = 684 Score = 28.7 bits (61), Expect = 0.56 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = -2 Query: 208 TVLRFSNWATLLSKVSRIRRETYFHMITFKLIFTCIL 98 T F+N L K S ++R++Y H+ ++L+ C L Sbjct: 194 TAEEFANVLLKLMKASTVKRKSYSHLGDYELVTNCSL 230 >SPAC29B12.12 |||helper of TIM |Schizosaccharomyces pombe|chr 1|||Manual Length = 113 Score = 27.9 bits (59), Expect = 0.97 Identities = 20/78 (25%), Positives = 33/78 (42%) Frame = -3 Query: 432 CGICILYESADLCTSQLLIHCSM*WHQSKFCAQNSIVCCLSRHSYTSSSIYKMKTNEMEY 253 CG C + + C +L H + W ++KF ++C ++S T Y+ T +Y Sbjct: 37 CGQCEKFYACFQCHDELNTHPFLPWRKAKFHIP-CVICGACKNSLTVEE-YR-STVHCKY 93 Query: 252 IDFFHQMNSNC*QHQQCY 199 + H N C H Y Sbjct: 94 CN--HPFNPKCKNHAGYY 109 >SPAC4D7.01c |sec71|sec7a, SPAP8A3.15c|Sec7 domain|Schizosaccharomyces pombe|chr 1|||Manual Length = 1811 Score = 27.5 bits (58), Expect = 1.3 Identities = 7/31 (22%), Positives = 23/31 (74%) Frame = +3 Query: 240 EKSLCTPSRWFSSYKCLSSCRNDGTNSKRWN 332 +++LC ++++++C+SS ++D +++ +N Sbjct: 1689 QEALCAKLYFYTAFECMSSLKSDSHDTEEYN 1719 >SPCC16C4.06c |||tRNA pseudouridylate synthase |Schizosaccharomyces pombe|chr 3|||Manual Length = 413 Score = 27.1 bits (57), Expect = 1.7 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = -3 Query: 351 SKFCAQNSIVCCLSRHSYTSSSIYKMKTNEMEY 253 S+F A S++C L RH SSI M Y Sbjct: 8 SRFSANQSVLCLLQRHRVFFSSISVKPRKRMVY 40 >SPBP8B7.12c |fta3|sma3|Sim4 and Mal2 associated |Schizosaccharomyces pombe|chr 2|||Manual Length = 220 Score = 26.2 bits (55), Expect = 3.0 Identities = 15/42 (35%), Positives = 25/42 (59%) Frame = -2 Query: 349 QVLCSKFHRLLFVPSFLHELKHL*DENQRDGVHRLFSSDELE 224 Q L + + L F+ S L+E +HL +EN + F+S+E+E Sbjct: 89 QRLYDESNSLGFISSPLNETEHLSEENLKIESSITFTSEEIE 130 >SPAC1006.09 |win1|SPAC1250.06c, SPAPJ730.01|MAP kinase kinase kinase Win1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1436 Score = 25.8 bits (54), Expect = 3.9 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +2 Query: 362 YMEQWINNWLVHKSADSYK 418 +ME W WL H+S DSY+ Sbjct: 361 WMEIWC--WLTHRSVDSYR 377 >SPAC3H8.04 |||chromosome segregation protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 338 Score = 24.6 bits (51), Expect = 9.0 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -2 Query: 508 MEHMKYGRKLFTICDKVGH 452 + H+K+G +L IC GH Sbjct: 284 LSHLKFGLQLQIICTSAGH 302 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,144,409 Number of Sequences: 5004 Number of extensions: 44351 Number of successful extensions: 114 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 112 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 114 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 212331630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -