BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS310D01f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ515150-1|CAD56157.2| 737|Anopheles gambiae acetylcholinestera... 25 1.2 AJ515149-1|CAD56156.1| 737|Anopheles gambiae acetylcholinestera... 25 1.2 AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcript... 24 2.7 AF269156-1|AAF91401.1| 52|Anopheles gambiae transcription fact... 23 4.7 AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydroge... 23 8.2 >AJ515150-1|CAD56157.2| 737|Anopheles gambiae acetylcholinesterase protein. Length = 737 Score = 25.4 bits (53), Expect = 1.2 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = +1 Query: 265 VGFHLINA*ARVGMTGQTANDGIL-STELGLMPLHGA 372 +G H ++A A VG++ Q+A G L S + +P GA Sbjct: 51 IGSHQLSAAAGVGLSSQSAQSGSLASGVMSSVPAAGA 87 >AJ515149-1|CAD56156.1| 737|Anopheles gambiae acetylcholinesterase protein. Length = 737 Score = 25.4 bits (53), Expect = 1.2 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = +1 Query: 265 VGFHLINA*ARVGMTGQTANDGIL-STELGLMPLHGA 372 +G H ++A A VG++ Q+A G L S + +P GA Sbjct: 51 IGSHQLSAAAGVGLSSQSAQSGSLASGVMSSVPAAGA 87 >AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcriptase protein. Length = 973 Score = 24.2 bits (50), Expect = 2.7 Identities = 12/39 (30%), Positives = 24/39 (61%) Frame = -2 Query: 241 SSDELELLTTPTVLRFSNWATLLSKVSRIRRETYFHMIT 125 S +E+ELLT+ +V R +W + ++ ++T F +I+ Sbjct: 645 SIEEIELLTSDSVSRIESWMQQM-RLEIAHKKTEFLIIS 682 >AF269156-1|AAF91401.1| 52|Anopheles gambiae transcription factor zen protein. Length = 52 Score = 23.4 bits (48), Expect = 4.7 Identities = 7/16 (43%), Positives = 14/16 (87%) Frame = +3 Query: 396 TSQLIHIKYKYHSNQY 443 +SQL+ ++ ++HSN+Y Sbjct: 9 SSQLVELEKEFHSNRY 24 >AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydrogenase protein. Length = 1325 Score = 22.6 bits (46), Expect = 8.2 Identities = 7/14 (50%), Positives = 12/14 (85%) Frame = -2 Query: 268 QRDGVHRLFSSDEL 227 +++G HR FS+D+L Sbjct: 615 EQEGCHRFFSADDL 628 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 532,741 Number of Sequences: 2352 Number of extensions: 10214 Number of successful extensions: 13 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -