SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ovS310D01f
         (521 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z81513-13|CAB04180.2| 1213|Caenorhabditis elegans Hypothetical p...    29   1.5  

>Z81513-13|CAB04180.2| 1213|Caenorhabditis elegans Hypothetical
           protein F26D2.10 protein.
          Length = 1213

 Score = 29.5 bits (63), Expect = 1.5
 Identities = 21/72 (29%), Positives = 35/72 (48%)
 Frame = +3

Query: 273 SSYKCLSSCRNDGTNSKRWNFEHRTWIDAITWSSGLIIGWYTSQLIHIKYKYHSNQYQKK 452
           +SY+ LS+ ++    +       +T  + IT S G I+G   S L  ++     +QY K 
Sbjct: 511 NSYEFLSTIKSIAKIASELQVVQKT-AENITVSDGNILGDLISNLSLVETSKCFSQYYKT 569

Query: 453 CPTLSHIVNSLR 488
            PTL   V+ L+
Sbjct: 570 MPTLESTVSKLK 581


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,677,096
Number of Sequences: 27780
Number of extensions: 245386
Number of successful extensions: 750
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 735
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 750
length of database: 12,740,198
effective HSP length: 77
effective length of database: 10,601,138
effective search space used: 1017709248
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -