BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS310C08f (521 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q8I2T5 Cluster: Putative uncharacterized protein PFI107... 38 0.14 UniRef50_Q4Z0C1 Cluster: Putative uncharacterized protein; n=3; ... 37 0.32 UniRef50_Q54NS7 Cluster: Putative uncharacterized protein; n=1; ... 35 1.3 UniRef50_Q8I3C5 Cluster: Putative uncharacterized protein PFI011... 34 2.3 UniRef50_Q73AM1 Cluster: NADH dehydrogenase subunit 3, putative;... 32 6.9 UniRef50_A4CID7 Cluster: Putative uncharacterized protein; n=2; ... 32 6.9 UniRef50_Q8IEN1 Cluster: Putative uncharacterized protein MAL13P... 32 6.9 UniRef50_Q54WQ2 Cluster: Putative uncharacterized protein; n=1; ... 32 6.9 UniRef50_P15605 Cluster: Uncharacterized mitochondrial protein O... 32 9.2 >UniRef50_Q8I2T5 Cluster: Putative uncharacterized protein PFI1070c; n=4; Plasmodium|Rep: Putative uncharacterized protein PFI1070c - Plasmodium falciparum (isolate 3D7) Length = 395 Score = 37.9 bits (84), Expect = 0.14 Identities = 12/38 (31%), Positives = 25/38 (65%) Frame = +1 Query: 214 HFNNVYQHLFIYLSNFLFLFYLINIVFFFFRYNNINSK 327 H+ + + H IY+ +++++ L +FFF+RYN ++ K Sbjct: 272 HYKSYHTHTHIYIYIYIYIYILYMRIFFFYRYNFVDKK 309 >UniRef50_Q4Z0C1 Cluster: Putative uncharacterized protein; n=3; Plasmodium (Vinckeia)|Rep: Putative uncharacterized protein - Plasmodium berghei Length = 275 Score = 36.7 bits (81), Expect = 0.32 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +1 Query: 463 PRGGARXPIRPIVSRIT 513 PRGGAR PIRPIVSRIT Sbjct: 259 PRGGARYPIRPIVSRIT 275 >UniRef50_Q54NS7 Cluster: Putative uncharacterized protein; n=1; Dictyostelium discoideum AX4|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 195 Score = 34.7 bits (76), Expect = 1.3 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = +1 Query: 241 FIYLSNFLFLFYLINIVFFFF 303 FIY NF+ LF ++NI+FFFF Sbjct: 6 FIYYHNFILLFLVLNILFFFF 26 >UniRef50_Q8I3C5 Cluster: Putative uncharacterized protein PFI0110c; n=1; Plasmodium falciparum 3D7|Rep: Putative uncharacterized protein PFI0110c - Plasmodium falciparum (isolate 3D7) Length = 608 Score = 33.9 bits (74), Expect = 2.3 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 217 FNNVYQHLFIYLSNFLFLFYLINIVFFFFRYNNINSKC 330 +NN Y LF+ L F+ +I++ FFF I +KC Sbjct: 14 YNNKYIGLFLNLKGFVMYLLVISLYFFFLFLTEIQNKC 51 >UniRef50_Q73AM1 Cluster: NADH dehydrogenase subunit 3, putative; n=1; Bacillus cereus ATCC 10987|Rep: NADH dehydrogenase subunit 3, putative - Bacillus cereus (strain ATCC 10987) Length = 103 Score = 32.3 bits (70), Expect = 6.9 Identities = 15/39 (38%), Positives = 24/39 (61%), Gaps = 2/39 (5%) Frame = +1 Query: 214 HFNNVYQHLFIYLSNFLFLF--YLINIVFFFFRYNNINS 324 +F V + LF +SNF FLF + +V+F F + N+N+ Sbjct: 37 YFLVVCERLFYNISNFFFLFQWFFYKVVYFRFFFRNLNN 75 >UniRef50_A4CID7 Cluster: Putative uncharacterized protein; n=2; Flavobacteriales|Rep: Putative uncharacterized protein - Robiginitalea biformata HTCC2501 Length = 382 Score = 32.3 bits (70), Expect = 6.9 Identities = 19/44 (43%), Positives = 27/44 (61%) Frame = +1 Query: 4 FFFFLNTIAVSIVANRKNKATDTAHEHRRLILRT*E*IVALGFF 135 F FFL + SIV +NK D A HR++I+RT + ++ LG F Sbjct: 70 FPFFLFIVGTSIVFAYRNKQPDAA-THRKIIVRTLK-LILLGIF 111 >UniRef50_Q8IEN1 Cluster: Putative uncharacterized protein MAL13P1.39; n=1; Plasmodium falciparum 3D7|Rep: Putative uncharacterized protein MAL13P1.39 - Plasmodium falciparum (isolate 3D7) Length = 6088 Score = 32.3 bits (70), Expect = 6.9 Identities = 25/62 (40%), Positives = 30/62 (48%), Gaps = 3/62 (4%) Frame = +1 Query: 151 YVNRNVIALCWR*IRV*LCNEHFNNVYQHLFIYLSNFLFLFYLINIVF---FFFRYNNIN 321 Y N N+I +C IR H + LF Y SN L L NI+F FF YNNI Sbjct: 1724 YYNDNIINICDNKIRKKKKKNHDKFILM-LFYYHSNMLKDNKLYNIIFDVIRFFLYNNII 1782 Query: 322 SK 327 +K Sbjct: 1783 TK 1784 >UniRef50_Q54WQ2 Cluster: Putative uncharacterized protein; n=1; Dictyostelium discoideum AX4|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 1236 Score = 32.3 bits (70), Expect = 6.9 Identities = 14/33 (42%), Positives = 22/33 (66%) Frame = +1 Query: 226 VYQHLFIYLSNFLFLFYLINIVFFFFRYNNINS 324 +Y +++ L N+LF+ + IN FF FR NIN+ Sbjct: 730 IYLFIYLLLVNYLFINFFIN--FFIFRIPNINN 760 >UniRef50_P15605 Cluster: Uncharacterized mitochondrial protein ORF4; n=1; Paramecium tetraurelia|Rep: Uncharacterized mitochondrial protein ORF4 - Paramecium tetraurelia Length = 156 Score = 31.9 bits (69), Expect = 9.2 Identities = 18/57 (31%), Positives = 32/57 (56%), Gaps = 3/57 (5%) Frame = +1 Query: 229 YQHLFIYLSNFLFLFYLINIVFFFF---RYNNINSKCK*TIEA*TYFT*ILYLIINN 390 + F+Y S LF F + ++FFFF Y+N+N C +I + T ++YL+ ++ Sbjct: 100 FTSFFVYFSYLLFFFVPVFVLFFFFYLTTYDNLN--CFFSISSVINSTFLVYLLASS 154 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 444,888,796 Number of Sequences: 1657284 Number of extensions: 7709486 Number of successful extensions: 18646 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 17209 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18353 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 32619212418 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -