BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS310C08f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 23 1.2 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 23 1.6 DQ659252-1|ABG47450.1| 377|Tribolium castaneum chitinase 13 pro... 21 6.6 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 23.4 bits (48), Expect = 1.2 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = -3 Query: 231 IDIVKMLITKLHSYLAPTEGDNVPIYILSI 142 +D + ++ LH G N P+Y SI Sbjct: 203 LDFINVMAYDLHGSWESVTGQNAPLYASSI 232 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 23.0 bits (47), Expect = 1.6 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = -1 Query: 182 QQRAITFRFTYCPY*KKKPKATIYS 108 Q I F F YC Y K K +Y+ Sbjct: 264 QFNTIVFSFCYCYYNSKMTKDGVYN 288 >DQ659252-1|ABG47450.1| 377|Tribolium castaneum chitinase 13 protein. Length = 377 Score = 21.0 bits (42), Expect = 6.6 Identities = 7/27 (25%), Positives = 15/27 (55%) Frame = -3 Query: 234 LIDIVKMLITKLHSYLAPTEGDNVPIY 154 ++DI+ ++ H+ A +N P+Y Sbjct: 193 VLDIINVMTYDFHAMWAGFTAENSPLY 219 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 116,181 Number of Sequences: 336 Number of extensions: 2573 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -