BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS310C06f (521 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC21C3.18 |spo4||serine/threonine protein kinase Spo4|Schizosa... 25 9.0 SPAPB18E9.04c |||sequence orphan|Schizosaccharomyces pombe|chr 1... 25 9.0 >SPBC21C3.18 |spo4||serine/threonine protein kinase Spo4|Schizosaccharomyces pombe|chr 2|||Manual Length = 429 Score = 24.6 bits (51), Expect = 9.0 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = +2 Query: 170 HNYFYSGHVPELANRKVDWLD 232 H +S ++P L ++K +WLD Sbjct: 331 HGQIWSDNIPTLLDQKHNWLD 351 >SPAPB18E9.04c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 800 Score = 24.6 bits (51), Expect = 9.0 Identities = 19/66 (28%), Positives = 31/66 (46%), Gaps = 2/66 (3%) Frame = +3 Query: 81 SRPHRS-PVVSCRFPLRINVLTDQRNSFTKDTTTSTAVTFPS*P-TGK*TGWTDATFAVN 254 S P+ S PV S + + + T + TTST+V + S P T T+ T + + Sbjct: 501 SVPYTSTPVTSSNYTISSSTPVTSTPVTTTNCTTSTSVLYTSTPVTSTPLATTNCTTSTS 560 Query: 255 TAWTSS 272 +TS+ Sbjct: 561 VPYTST 566 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,059,400 Number of Sequences: 5004 Number of extensions: 39329 Number of successful extensions: 106 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 103 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 106 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 212331630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -