BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS310B12f (488 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC29A4.16 |hal4|sat4, ppk10|halotolerence protein 4|Schizosacc... 29 0.28 SPCC1494.05c |ubp12||ubiquitin C-terminal hydrolase Ubp12|Schizo... 29 0.50 SPBC30D10.17c |||glucan synthase regulator |Schizosaccharomyces ... 25 4.6 SPAC1071.03c |||sequence orphan|Schizosaccharomyces pombe|chr 1|... 25 6.1 SPAC343.11c |msc1||multi-copy suppressor of Chk1 |Schizosaccharo... 25 6.1 >SPAC29A4.16 |hal4|sat4, ppk10|halotolerence protein 4|Schizosaccharomyces pombe|chr 1|||Manual Length = 636 Score = 29.5 bits (63), Expect = 0.28 Identities = 13/36 (36%), Positives = 23/36 (63%) Frame = -3 Query: 441 RPGVVICAPAAXLDVVAVSQAPSPESNPDSPLPVTT 334 + GVV AA + V++V+ +P+P + + P PV+T Sbjct: 163 KAGVVSNPAAANVHVLSVAASPNPSTPSNGPAPVST 198 >SPCC1494.05c |ubp12||ubiquitin C-terminal hydrolase Ubp12|Schizosaccharomyces pombe|chr 3|||Manual Length = 979 Score = 28.7 bits (61), Expect = 0.50 Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 3/38 (7%) Frame = +3 Query: 294 CLINFRW*F---LRLPWLSRVTGNQGSIPEREPEKRLP 398 C+IN W LRL +L + NQ S E++ EKR+P Sbjct: 271 CMINETWPVDRALRLQFLIQQRNNQSSNEEQKQEKRVP 308 >SPBC30D10.17c |||glucan synthase regulator |Schizosaccharomyces pombe|chr 2|||Manual Length = 504 Score = 25.4 bits (53), Expect = 4.6 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -3 Query: 405 LDVVAVSQAPSPESNPDSPLPVTTMVVAETTIES 304 L ++ S+ P + PD P T+ V+ TT+E+ Sbjct: 422 LGLINTSEINQPANLPDEPTAETSNPVSATTVEA 455 >SPAC1071.03c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 338 Score = 25.0 bits (52), Expect = 6.1 Identities = 11/35 (31%), Positives = 22/35 (62%) Frame = +1 Query: 58 NGSIYQFWFLRSYSVTWITVVILELIHAIRTLTSD 162 N IY+ +F ++S++ + + I L +RT++SD Sbjct: 14 NTQIYRIFFTLTFSLSNLFLAICYLFLNVRTVSSD 48 >SPAC343.11c |msc1||multi-copy suppressor of Chk1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1588 Score = 25.0 bits (52), Expect = 6.1 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = +3 Query: 348 TGNQGSIPEREPEKRLPHPXXQQARKLPLRDGSS 449 TGN G P P KR+ KL ++GSS Sbjct: 275 TGNDGGSPINRPAKRVKRQNHIPKCKLCAQEGSS 308 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,953,722 Number of Sequences: 5004 Number of extensions: 37483 Number of successful extensions: 83 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 79 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 83 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 190087364 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -