BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS310B11f (521 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC31E1.05 |gle1||RNA export factor Gle1 |Schizosaccharomyces p... 25 9.0 SPAC140.03 |arb1||argonaute binding protein 1|Schizosaccharomyce... 25 9.0 >SPBC31E1.05 |gle1||RNA export factor Gle1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 480 Score = 24.6 bits (51), Expect = 9.0 Identities = 14/47 (29%), Positives = 27/47 (57%) Frame = -3 Query: 267 QKEIEDKQAFRLREKLVRKKHRNLYKSMKAGQEKRKKEIWLLRKKRR 127 +K+ +++ F RE L +K+ + +K +E+RKKE+ KK + Sbjct: 104 EKQRLEQERFN-RELLEKKRIEAERQRLKDEEERRKKELMEKEKKEK 149 >SPAC140.03 |arb1||argonaute binding protein 1|Schizosaccharomyces pombe|chr 1|||Manual Length = 399 Score = 24.6 bits (51), Expect = 9.0 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -1 Query: 149 GCLGKNVAFTTRRSKMKRRQKNGNKK 72 GC+G +V FTT + + + N KK Sbjct: 12 GCIGDSVEFTTFKKRTGKSLGNRRKK 37 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,407,713 Number of Sequences: 5004 Number of extensions: 21330 Number of successful extensions: 74 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 71 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 74 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 212331630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -