BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS310B05f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 23 2.5 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 5.8 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 21 7.7 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 22.6 bits (46), Expect = 2.5 Identities = 12/49 (24%), Positives = 23/49 (46%) Frame = -2 Query: 343 HAKWNPTAGVSFEYDPDNIMRHTLYPKPDEWPKSEHTELNEDQYEADFN 197 H++ + A S + + T + ++ KSEH E ++ Y A F+ Sbjct: 747 HSEASANANSSTSSEESREEKATTSLEAEKREKSEHCEKGKEYYAASFH 795 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.4 bits (43), Expect = 5.8 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +2 Query: 356 TFFCICPKLQFLTLA*LNDQYFICFTIIG 442 T +C+ P + L D+ IC T IG Sbjct: 198 TRYCLTPTERLEALCWTQDEDIICSTPIG 226 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.0 bits (42), Expect = 7.7 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +2 Query: 356 TFFCICPKLQFLTLA*LNDQYFICFTIIG 442 T +C+ P + L D+ IC T IG Sbjct: 145 TRYCLTPTERLEALCWTQDEDVICSTPIG 173 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 136,521 Number of Sequences: 438 Number of extensions: 2834 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -