BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS310B04f (375 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A5DY70 Cluster: Putative uncharacterized protein; n=2; ... 32 3.0 UniRef50_P11976 Cluster: Prestalk protein precursor; n=7; Dictyo... 31 5.2 UniRef50_A0C3E8 Cluster: Chromosome undetermined scaffold_147, w... 31 9.1 >UniRef50_A5DY70 Cluster: Putative uncharacterized protein; n=2; Saccharomycetales|Rep: Putative uncharacterized protein - Lodderomyces elongisporus (Yeast) (Saccharomyces elongisporus) Length = 638 Score = 32.3 bits (70), Expect = 3.0 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +3 Query: 30 AIRSG*SSTDYSSELVRKRSRHRSFPNGAVLQTTINERLES 152 A S +ST SS R+ RH+SF N A L T + RLE+ Sbjct: 63 ASSSSLTSTSTSSSSKRRSKRHKSFINIAPLNTPLQHRLET 103 >UniRef50_P11976 Cluster: Prestalk protein precursor; n=7; Dictyostelium|Rep: Prestalk protein precursor - Dictyostelium discoideum (Slime mold) Length = 1046 Score = 31.5 bits (68), Expect = 5.2 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -1 Query: 105 ENCDDANACALVH*NSLCCSN 43 ENC+D N C L N+ CCSN Sbjct: 25 ENCNDGNKCTLDKCNNGCCSN 45 >UniRef50_A0C3E8 Cluster: Chromosome undetermined scaffold_147, whole genome shotgun sequence; n=2; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_147, whole genome shotgun sequence - Paramecium tetraurelia Length = 321 Score = 30.7 bits (66), Expect = 9.1 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = +3 Query: 36 RSG*SSTDYSSELVRKRSRHRSFPNGAVLQTTINERLESHCS 161 + G D+S+E + K R RS NG L ERLE+ CS Sbjct: 6 KKGDQVEDFSTEQLNKLYRKRSEINGVPLCKIFKERLEAVCS 47 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 337,903,700 Number of Sequences: 1657284 Number of extensions: 5093145 Number of successful extensions: 11126 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 10890 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11122 length of database: 575,637,011 effective HSP length: 91 effective length of database: 424,824,167 effective search space used: 14019197511 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -