BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS310B04f (375 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC887.11 |pus2||tRNA pseudouridylate synthase Pus2 |Schizosacc... 27 1.3 SPAC31A2.05c |mis4||cohesin loading factor Mis4|Schizosaccharomy... 26 1.7 SPAC3G6.08 |erv1||sulfhydryl oxidase |Schizosaccharomyces pombe|... 26 1.7 SPBC582.10c |||ATP-dependent DNA helicase Rhp16b |Schizosaccharo... 26 1.7 SPAPB1A10.14 |||F-box protein, unnamed|Schizosaccharomyces pombe... 25 5.1 SPBC839.02 |||arrestin Aly1 related|Schizosaccharomyces pombe|ch... 24 6.8 >SPBC887.11 |pus2||tRNA pseudouridylate synthase Pus2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 451 Score = 26.6 bits (56), Expect = 1.3 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = +1 Query: 76 CASVRVIAVFPTERYYRPQ 132 C+ +RV +VFP +Y+ P+ Sbjct: 131 CSQIRVWSVFPAPKYFNPR 149 >SPAC31A2.05c |mis4||cohesin loading factor Mis4|Schizosaccharomyces pombe|chr 1|||Manual Length = 1583 Score = 26.2 bits (55), Expect = 1.7 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +2 Query: 149 VTLFSSYCDINREG*NWCHVLLFI 220 + LFS Y D+NR +W H L FI Sbjct: 1150 IGLFSRYGDLNRINDDWKHSLDFI 1173 >SPAC3G6.08 |erv1||sulfhydryl oxidase |Schizosaccharomyces pombe|chr 1|||Manual Length = 182 Score = 26.2 bits (55), Expect = 1.7 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = -3 Query: 340 YPRWSAAEDHRXNRSKGTECSNSNRVDTR 254 YP WS AED R +K NS RVD+R Sbjct: 120 YPCWSCAEDLRIWMAK---YGNSPRVDSR 145 >SPBC582.10c |||ATP-dependent DNA helicase Rhp16b |Schizosaccharomyces pombe|chr 2|||Manual Length = 830 Score = 26.2 bits (55), Expect = 1.7 Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 4/49 (8%) Frame = -1 Query: 243 HSVMKYFKIN----NKTWHQFQPSRLISQYEENSVTQGVRLLWSVIPLR 109 +S++K+ IN W Q S + Q EEN V + +R+L SVI LR Sbjct: 424 YSLVKFLHINPFNDQSVWKD-QISLPLCQGEENLVFKRLRMLLSVIMLR 471 >SPAPB1A10.14 |||F-box protein, unnamed|Schizosaccharomyces pombe|chr 1|||Manual Length = 243 Score = 24.6 bits (51), Expect = 5.1 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 205 MAPVSTFTINITIRREQCDSRRSFIVVCNTAPL 107 +AP I++T+ R CD ++ I C P+ Sbjct: 146 LAPHINVRIHVTLSRSSCDRHQADIFSCFQDPI 178 >SPBC839.02 |||arrestin Aly1 related|Schizosaccharomyces pombe|chr 2|||Manual Length = 530 Score = 24.2 bits (50), Expect = 6.8 Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = -1 Query: 225 FKINNKT-WHQFQPSRLISQYEENSV 151 FK ++T W + P +L YEENS+ Sbjct: 120 FKGKSRTEWPEGIPPKLFDTYEENSI 145 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,372,935 Number of Sequences: 5004 Number of extensions: 21128 Number of successful extensions: 40 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 39 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 40 length of database: 2,362,478 effective HSP length: 65 effective length of database: 2,037,218 effective search space used: 120195862 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -