Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ovS310B04f
         (375 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY705405-1|AAU12514.1|  519|Anopheles gambiae nicotinic acetylch...    25   1.2  
AJ459959-1|CAD31058.1|  462|Anopheles gambiae dopachrome convers...    24   1.6  
AF119382-1|AAD27585.1|  394|Anopheles gambiae caudal protein hom...    24   1.6  
AY705396-1|AAU12505.1|  710|Anopheles gambiae nicotinic acetylch...    23   5.0  
AF457565-1|AAL68795.1|  391|Anopheles gambiae TRIO protein protein.    23   5.0  

>AY705405-1|AAU12514.1|  519|Anopheles gambiae nicotinic
           acetylcholine receptor subunitbeta 1 protein.
          Length = 519

 Score = 24.6 bits (51), Expect = 1.2
 Identities = 11/33 (33%), Positives = 20/33 (60%), Gaps = 3/33 (9%)
 Frame = -1

Query: 183 RLISQYEENSVTQG---VRLLWSVIPLRWENCD 94
           +LI+  E+N + +    +RL+WS   L+W+  D
Sbjct: 62  QLINVNEKNQIMKSNVWLRLVWSDYQLQWDEAD 94


>AJ459959-1|CAD31058.1|  462|Anopheles gambiae dopachrome conversion
           enzyme protein.
          Length = 462

 Score = 24.2 bits (50), Expect = 1.6
 Identities = 9/43 (20%), Positives = 19/43 (44%)
 Frame = -1

Query: 255 DIATHSVMKYFKINNKTWHQFQPSRLISQYEENSVTQGVRLLW 127
           D+ T+ ++ Y   N + W        ++  E + + QG+   W
Sbjct: 201 DLQTYRMVVYDYANRRAWRFLHNYFFLNPLEGDYLIQGINFAW 243


>AF119382-1|AAD27585.1|  394|Anopheles gambiae caudal protein
           homolog protein.
          Length = 394

 Score = 24.2 bits (50), Expect = 1.6
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = +2

Query: 326 GPPGIHHHHP 355
           G  G+HHHHP
Sbjct: 344 GSMGLHHHHP 353


>AY705396-1|AAU12505.1|  710|Anopheles gambiae nicotinic
           acetylcholine receptor subunitalpha 3 protein.
          Length = 710

 Score = 22.6 bits (46), Expect = 5.0
 Identities = 8/11 (72%), Positives = 8/11 (72%)
 Frame = +2

Query: 320 RSGPPGIHHHH 352
           RSG  G HHHH
Sbjct: 426 RSGGGGRHHHH 436


>AF457565-1|AAL68795.1|  391|Anopheles gambiae TRIO protein protein.
          Length = 391

 Score = 22.6 bits (46), Expect = 5.0
 Identities = 8/9 (88%), Positives = 9/9 (100%)
 Frame = -1

Query: 375 RLVDSVKGW 349
           RL+DSVKGW
Sbjct: 41  RLLDSVKGW 49


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 364,610
Number of Sequences: 2352
Number of extensions: 6426
Number of successful extensions: 11
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 563,979
effective HSP length: 57
effective length of database: 429,915
effective search space used: 28804305
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)