BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS310B02f (521 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1A6.01c ||SPAC23C4.20c|human thyroid receptor interacting pr... 27 1.7 SPAC17D4.02 |cdc45|sna41, goa1|DNA replication pre-initiation co... 26 3.0 SPAC17G8.07 |||YEATS family protein|Schizosaccharomyces pombe|ch... 26 3.9 SPCC1739.13 |ssa2||heat shock protein Ssa2|Schizosaccharomyces p... 26 3.9 SPCC188.03 |cnd3||condensin subunit Cnd3 |Schizosaccharomyces po... 26 3.9 SPAC2H10.01 |||transcription factor, zf-fungal binuclear cluster... 26 3.9 SPBC14F5.11c |mug186||sorting nexin Snx41|Schizosaccharomyces po... 25 6.8 >SPAC1A6.01c ||SPAC23C4.20c|human thyroid receptor interacting protein homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 455 Score = 27.1 bits (57), Expect = 1.7 Identities = 14/58 (24%), Positives = 31/58 (53%) Frame = +1 Query: 97 KEVKKRQQRVLMILDSKNIKYEVIDITEPGRESDKDFMQNNAKSSGGTVSDPNPRSPL 270 K+ KK+++ + + L K + + + + + D+D + N K G + S NP++P+ Sbjct: 354 KKEKKKKKVLSISLSGKKVVVDQKEASSESSDEDQDELDNLTKVEGQSHSH-NPKAPV 410 >SPAC17D4.02 |cdc45|sna41, goa1|DNA replication pre-initiation complex subunit Cdc45|Schizosaccharomyces pombe|chr 1|||Manual Length = 638 Score = 26.2 bits (55), Expect = 3.0 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +1 Query: 286 NDEEYCGDYDQFDLANEVDTLEQFLKL 366 N E YD +D ++VD+LE+ LKL Sbjct: 455 NQEWLHNFYDAYDALDDVDSLERALKL 481 >SPAC17G8.07 |||YEATS family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 217 Score = 25.8 bits (54), Expect = 3.9 Identities = 14/50 (28%), Positives = 21/50 (42%) Frame = +1 Query: 145 KNIKYEVIDITEPGRESDKDFMQNNAKSSGGTVSDPNPRSPLPPQMFNDE 294 ++++YE I EP + K QN G + P P Q+ DE Sbjct: 133 ESVQYEEIVFNEPFEYTYKLLSQNPIGDGHGLAVESEPDHPFSQQLEQDE 182 >SPCC1739.13 |ssa2||heat shock protein Ssa2|Schizosaccharomyces pombe|chr 3|||Manual Length = 647 Score = 25.8 bits (54), Expect = 3.9 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +1 Query: 154 KYEVIDITEPGRESDKDFMQNNAKSSGGTVSDPN 255 KY+ D E GR K+ +++ A S ++ DPN Sbjct: 522 KYKAEDEAESGRIQAKNHLESYAYSLRNSLDDPN 555 >SPCC188.03 |cnd3||condensin subunit Cnd3 |Schizosaccharomyces pombe|chr 3|||Manual Length = 875 Score = 25.8 bits (54), Expect = 3.9 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = +1 Query: 178 EPGRESDKDFMQNNAKSSGGTVSDPNPRSPLPPQMFNDEE 297 E G + + +N+ + TVS +P LPP N+ E Sbjct: 442 EQGNSNAPELNKNDYEGEEITVSQKSPSPSLPPNELNEPE 481 >SPAC2H10.01 |||transcription factor, zf-fungal binuclear cluster type|Schizosaccharomyces pombe|chr 1|||Manual Length = 480 Score = 25.8 bits (54), Expect = 3.9 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +1 Query: 217 NAKSSGGTVSDPNPRSPLPPQMFNDEEY 300 NAK S G + PLPPQ FN +Y Sbjct: 394 NAKQSSGKLG------PLPPQSFNSSDY 415 >SPBC14F5.11c |mug186||sorting nexin Snx41|Schizosaccharomyces pombe|chr 2|||Manual Length = 586 Score = 25.0 bits (52), Expect = 6.8 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +1 Query: 187 RESDKDFMQNNAKSSGGTVSDPNPRSPLPPQMFNDEE 297 RES+ NNA++S T+ + +P +FNDEE Sbjct: 393 RESEATLGVNNAQTSRSTIPEEDP-------LFNDEE 422 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.314 0.135 0.380 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,625,715 Number of Sequences: 5004 Number of extensions: 30269 Number of successful extensions: 75 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 74 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 75 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 212331630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits)
- SilkBase 1999-2023 -