BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS310A12f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 23 1.9 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 21 5.8 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 21 7.7 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 23.0 bits (47), Expect = 1.9 Identities = 11/29 (37%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = +2 Query: 158 CQHAYGNHQWRQRHLLHHGAT-QRLHRCN 241 CQ A+ Q HL HG + +RCN Sbjct: 67 CQKAFDQKNLYQSHLRSHGKEGEDPYRCN 95 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 21.4 bits (43), Expect = 5.8 Identities = 12/40 (30%), Positives = 17/40 (42%) Frame = -3 Query: 435 FCNKRRCFLVSSLFYFHLQLHHQS*VRSSLEHLQR*TANR 316 FC RR L HL+ H + +++ Q T NR Sbjct: 226 FCAARRIVLEERRAQSHLEAHCYFDIEPTVQQHQPVTVNR 265 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 21.0 bits (42), Expect = 7.7 Identities = 6/16 (37%), Positives = 10/16 (62%) Frame = +1 Query: 103 TVLIMLVSCCHTSTYP 150 T ++ + +CC TYP Sbjct: 225 TKVLKMYACCPNDTYP 240 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 131,211 Number of Sequences: 438 Number of extensions: 2681 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -