BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS310A08f (415 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A7CT78 Cluster: Alpha/beta hydrolase fold-3 domain prot... 36 0.25 UniRef50_A0P364 Cluster: Putative uncharacterized protein; n=1; ... 32 5.3 >UniRef50_A7CT78 Cluster: Alpha/beta hydrolase fold-3 domain protein; n=1; Opitutaceae bacterium TAV2|Rep: Alpha/beta hydrolase fold-3 domain protein - Opitutaceae bacterium TAV2 Length = 325 Score = 36.3 bits (80), Expect = 0.25 Identities = 16/39 (41%), Positives = 23/39 (58%) Frame = +3 Query: 195 IKTCHLVSAHTSLE*MNMEKNISFHPIYLSSIQETSKLY 311 IK C +++ H L +N EKN H ++L S +E KLY Sbjct: 205 IKACVVMATHMDLVALNREKNSLGHVLFLGSFRENQKLY 243 >UniRef50_A0P364 Cluster: Putative uncharacterized protein; n=1; Stappia aggregata IAM 12614|Rep: Putative uncharacterized protein - Stappia aggregata IAM 12614 Length = 447 Score = 31.9 bits (69), Expect = 5.3 Identities = 18/49 (36%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = +2 Query: 167 RARNEFI*VHQNLPSCFSTHKSRINEYGKKYLIPS-HIPVIYPRNFQAI 310 R I +HQ +P+ F T+ SRI E + IPS I P N + I Sbjct: 296 RLHGNVIGLHQGIPAVFFTYDSRIRELSTLFAIPSVEIEDYMPINLEKI 344 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 375,806,746 Number of Sequences: 1657284 Number of extensions: 6845473 Number of successful extensions: 13073 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12800 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13070 length of database: 575,637,011 effective HSP length: 92 effective length of database: 423,166,883 effective search space used: 19042509735 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -