BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS309H12f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27096| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.009 SB_23259| Best HMM Match : zf-C2H2 (HMM E-Value=0) 33 0.19 SB_34420| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_4802| Best HMM Match : zf-C2H2 (HMM E-Value=9.1e-19) 32 0.33 SB_42899| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_30461| Best HMM Match : zf-C2H2 (HMM E-Value=0.064) 31 0.58 SB_43087| Best HMM Match : Ribosomal_S25 (HMM E-Value=3.2) 31 0.58 SB_27444| Best HMM Match : Phage_integrase (HMM E-Value=0.0013) 30 1.3 SB_16734| Best HMM Match : HLH (HMM E-Value=2.4e-08) 30 1.3 SB_13713| Best HMM Match : zf-C2H2 (HMM E-Value=3.8e-23) 30 1.3 SB_48551| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_17939| Best HMM Match : zf-C2H2 (HMM E-Value=1e-22) 29 2.3 SB_57| Best HMM Match : zf-C2H2 (HMM E-Value=0) 29 3.1 SB_38996| Best HMM Match : Pepsin-I3 (HMM E-Value=1.7) 29 3.1 SB_34562| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_21676| Best HMM Match : TrbF (HMM E-Value=0.99) 28 5.4 SB_57673| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_43023| Best HMM Match : Spindle_assoc (HMM E-Value=1.4) 27 7.1 SB_37977| Best HMM Match : PP2C (HMM E-Value=8.6e-08) 27 7.1 SB_36223| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_15809| Best HMM Match : zf-C2H2 (HMM E-Value=0) 27 7.1 SB_52263| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_38457| Best HMM Match : zf-C2H2 (HMM E-Value=0) 27 7.1 SB_19487| Best HMM Match : dsDNA_bind (HMM E-Value=5.2) 27 7.1 SB_157| Best HMM Match : dsDNA_bind (HMM E-Value=5.2) 27 7.1 SB_54976| Best HMM Match : MFS_1 (HMM E-Value=0.00064) 27 9.4 SB_13308| Best HMM Match : MFS_1 (HMM E-Value=0.0008) 27 9.4 SB_3213| Best HMM Match : zf-C2H2 (HMM E-Value=3.8e-40) 27 9.4 SB_52786| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_51861| Best HMM Match : RVT_1 (HMM E-Value=1.2e-10) 27 9.4 SB_42201| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_12715| Best HMM Match : Adeno_E1A (HMM E-Value=1.3) 27 9.4 SB_8983| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 >SB_27096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 949 Score = 37.1 bits (82), Expect = 0.009 Identities = 15/46 (32%), Positives = 22/46 (47%) Frame = +1 Query: 133 CSHCGESVQKPKVEKHYLTKCRNKNPNLSCMDCFKDFLGKDYESHI 270 C HC + V+ H LT+C K+ N C C + L D + H+ Sbjct: 843 CEHCSQVVEVSGFNDHLLTECDAKDRNAQCPRCKEVMLKVDLDDHL 888 >SB_23259| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1449 Score = 32.7 bits (71), Expect = 0.19 Identities = 22/68 (32%), Positives = 30/68 (44%), Gaps = 1/68 (1%) Frame = +1 Query: 97 STRVLQEMVVFTCSHCGESVQKPKVEKHYLTKCRNKNPNLSCMDCFKDFLGK-DYESHIK 273 STR + + TC CGES + +LT R + C C K +L K D H++ Sbjct: 1172 STRSHAKALHLTCFRCGESFSDRDEYRSHLTTHRT-GEKIVCKYCGKSWLRKADLTRHLR 1230 Query: 274 CITEEERY 297 T E Y Sbjct: 1231 VHTGERPY 1238 >SB_34420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 544 Score = 31.9 bits (69), Expect = 0.33 Identities = 15/57 (26%), Positives = 25/57 (43%), Gaps = 1/57 (1%) Frame = +1 Query: 127 FTCSHCGESVQKPKVEKHYLTKCRNKNPNLSCMDCFKDFLGKDYES-HIKCITEEER 294 F C HCG+ + K ++ C +C K FL + S H++ + E+ R Sbjct: 316 FKCGHCGKCLYNESYLKEHIRGVHKGQRPYKCGECGKCFLSISHLSDHVRTVHEKRR 372 >SB_4802| Best HMM Match : zf-C2H2 (HMM E-Value=9.1e-19) Length = 374 Score = 31.9 bits (69), Expect = 0.33 Identities = 17/59 (28%), Positives = 28/59 (47%), Gaps = 1/59 (1%) Frame = +1 Query: 127 FTCSHCGESVQKPKVEKHYLTKCRNKNPNLSCMDCFKDFLG-KDYESHIKCITEEERYS 300 FTC HC ES + ++ + N+ P C C + F G +HI+ T E+ ++ Sbjct: 291 FTCGHCSESFALSNELRTHVVQHTNEKP-FKCGFCSRTFAGITTLNNHIRTHTGEKPFN 348 >SB_42899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 490 Score = 31.1 bits (67), Expect = 0.58 Identities = 20/80 (25%), Positives = 32/80 (40%), Gaps = 6/80 (7%) Frame = +1 Query: 127 FTCSHCGESVQKPKVEKHYLTKCRNKNPNLSCMDCFKDFLGKDYE--SHIKCITEEERYS 300 F C HCG + ++ + K C C K F + YE HI T + Y+ Sbjct: 371 FKCKHCGRAFASHAAHDSHVRRTHTKEKPCICEYCGKAF-AQSYELKFHINMHTGAKPYT 429 Query: 301 ----GKGFTAKEKKGEKKQN 348 G+GF++ + + N Sbjct: 430 CEKCGRGFSSPSSRDRHRTN 449 >SB_30461| Best HMM Match : zf-C2H2 (HMM E-Value=0.064) Length = 197 Score = 31.1 bits (67), Expect = 0.58 Identities = 15/54 (27%), Positives = 25/54 (46%), Gaps = 1/54 (1%) Frame = +1 Query: 115 EMVVFTCSHCGESVQKPKVEKHYLTKCRNKNPNLSCMDCFKD-FLGKDYESHIK 273 E+ + CS CG + Q ++EKH +N D K G ++E ++K Sbjct: 128 ELDLSPCSICGRNFQTDRLEKHQKVCAKNSTRKRKAFDMTKQRTAGTEHEKYVK 181 >SB_43087| Best HMM Match : Ribosomal_S25 (HMM E-Value=3.2) Length = 134 Score = 31.1 bits (67), Expect = 0.58 Identities = 22/68 (32%), Positives = 30/68 (44%) Frame = +1 Query: 145 GESVQKPKVEKHYLTKCRNKNPNLSCMDCFKDFLGKDYESHIKCITEEERYSGKGFTAKE 324 G+ +K EK LT L ++C KD L E + ER GK AKE Sbjct: 12 GKKKKKKGDEKTELTIEDKYKRTLEEIECLKDELATRTELTRRARDTAERMKGKMLEAKE 71 Query: 325 KKGEKKQN 348 + G ++QN Sbjct: 72 EVGTEQQN 79 >SB_27444| Best HMM Match : Phage_integrase (HMM E-Value=0.0013) Length = 940 Score = 29.9 bits (64), Expect = 1.3 Identities = 18/87 (20%), Positives = 28/87 (32%) Frame = +1 Query: 70 FCIQNK*PQSTRVLQEMVVFTCSHCGESVQKPKVEKHYLTKCRNKNPNLSCMDCFKDFLG 249 FC Q + +S V V C C + C+ N C++ K + Sbjct: 300 FCFQKESCRSKEVSPPCAVMACCFCNRPIDVDIAVALTEKGCQTINEKSDCLESSKIHVT 359 Query: 250 KDYESHIKCITEEERYSGKGFTAKEKK 330 H+KC + R + E K Sbjct: 360 PGQRVHVKCCLDYTRRPAANKSVDENK 386 >SB_16734| Best HMM Match : HLH (HMM E-Value=2.4e-08) Length = 178 Score = 29.9 bits (64), Expect = 1.3 Identities = 19/86 (22%), Positives = 42/86 (48%) Frame = +2 Query: 254 IMNRISSALLKKKDTLEKVSQLRRKRVRKNKMLGSRCCSQF*MSKKVHLKMYVELLRQ*A 433 +MN I LL+ LE+ ++ +KR + + + ++ HL+ +ELL++ Sbjct: 1 MMNNIEQ-LLEAAKILEERDEVAKKRSPNSSRNQKKSARRSPSYRRAHLRDCLELLKELV 59 Query: 434 SITIHHERSLSLLILSKMSVDIKLIQ 511 H+++ +L +L I+++Q Sbjct: 60 PAPPEHQKATTLALLQSAQQYIQVLQ 85 >SB_13713| Best HMM Match : zf-C2H2 (HMM E-Value=3.8e-23) Length = 1084 Score = 29.9 bits (64), Expect = 1.3 Identities = 14/51 (27%), Positives = 26/51 (50%) Frame = +1 Query: 61 GYTFCIQNK*PQSTRVLQEMVVFTCSHCGESVQKPKVEKHYLTKCRNKNPN 213 G+ F + Q + Q++ F C +CG++ + V K ++ +C NPN Sbjct: 628 GWGFNLSGNLNQHMAIHQKVKPFKCVYCGKTFARSNVLKAHV-RCHTGNPN 677 >SB_48551| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 560 Score = 29.5 bits (63), Expect = 1.8 Identities = 19/74 (25%), Positives = 31/74 (41%), Gaps = 6/74 (8%) Frame = +1 Query: 127 FTCSHCGESVQKPKVEKHYLTKCRNKNPNLSCMDCFKDFLGKDYE--SHIKCITEEERYS 300 F C HCG++ ++ + K C C K F + YE HI T + Y+ Sbjct: 437 FKCKHCGKAFASHAAHDSHVRRTHTKEKPCVCHFCGKAF-AQSYELKFHINMHTGAKPYT 495 Query: 301 ----GKGFTAKEKK 330 G+GF++ + Sbjct: 496 CEKCGRGFSSPSSR 509 >SB_17939| Best HMM Match : zf-C2H2 (HMM E-Value=1e-22) Length = 203 Score = 29.1 bits (62), Expect = 2.3 Identities = 19/70 (27%), Positives = 34/70 (48%), Gaps = 2/70 (2%) Frame = +1 Query: 103 RVLQEMVVFTCSHCGESV-QKPKVEKHYLTKCRNKNPNLSCMDCFKDF-LGKDYESHIKC 276 R ++ +FTC +CG+ QK ++ H + + + P C C K F L +H++ Sbjct: 125 RTHSDVRMFTCQYCGKGFNQKGNLQAH-VYRHTGERP-FKCHICGKGFTLASTRTTHLRT 182 Query: 277 ITEEERYSGK 306 T E+ + K Sbjct: 183 HTNEKPFQCK 192 >SB_57| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1498 Score = 28.7 bits (61), Expect = 3.1 Identities = 16/59 (27%), Positives = 25/59 (42%), Gaps = 1/59 (1%) Frame = +1 Query: 127 FTCSHCGESVQKPKVEKHYLTKCRNKNPNLSCMDCFKDFLGK-DYESHIKCITEEERYS 300 FTCS CG++ ++ +L K C C K F + H+ C +E Y+ Sbjct: 535 FTCSECGQAFKRFNDMNIHL-KTHTSGDAFKCNTCDKRFCSAVNLNRHMLCHNQERPYA 592 >SB_38996| Best HMM Match : Pepsin-I3 (HMM E-Value=1.7) Length = 865 Score = 28.7 bits (61), Expect = 3.1 Identities = 14/43 (32%), Positives = 26/43 (60%), Gaps = 2/43 (4%) Frame = +2 Query: 83 TNSPNPHVFYKKWLFLHAVIVGSLFRSP--KWKSIISLNVGIK 205 TN + H + KW L V+V S+ R+P K ++I+ +N+ ++ Sbjct: 524 TNGVSMHELHHKWRTLKEVLVLSISRNPTNKLRNILLMNLHVR 566 >SB_34562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 978 Score = 28.3 bits (60), Expect = 4.1 Identities = 12/57 (21%), Positives = 24/57 (42%), Gaps = 1/57 (1%) Frame = +1 Query: 127 FTCSHCGESVQKPKVEKHYLTKCRNKNPNLSCMDCFKDFLGKD-YESHIKCITEEER 294 F C CG +K + H+ + C C K F ++ + H++ + +E+ Sbjct: 146 FECDQCGRCFKKNETLDHHHQNTHSGEKPYQCTQCDKLFGSQEILDRHVRAVHNQEK 202 >SB_21676| Best HMM Match : TrbF (HMM E-Value=0.99) Length = 681 Score = 27.9 bits (59), Expect = 5.4 Identities = 14/47 (29%), Positives = 26/47 (55%) Frame = +2 Query: 65 IHFAFKTNSPNPHVFYKKWLFLHAVIVGSLFRSPKWKSIISLNVGIK 205 +H A N+ H + KW L V+V S+ R+ K +++L+V ++ Sbjct: 298 LHIARHVNTRCQHELHHKWRNLKEVLVPSISRNLTNKLLMNLHVRLR 344 >SB_57673| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 508 Score = 27.5 bits (58), Expect = 7.1 Identities = 20/76 (26%), Positives = 32/76 (42%), Gaps = 3/76 (3%) Frame = +1 Query: 70 FCIQN-K*PQSTRVLQEMVV--FTCSHCGESVQKPKVEKHYLTKCRNKNPNLSCMDCFKD 240 FC N K QST + E C C +++ H L C P+L + +D Sbjct: 26 FCKDNTKTSQSTTSVDEAKTKYLFCHLCSQTLPLGGTCSHELGDCGRYGPSLDGITLIED 85 Query: 241 FLGKDYESHIKCITEE 288 F+ + E+ I + +E Sbjct: 86 FVSQREEARIVQVIDE 101 >SB_43023| Best HMM Match : Spindle_assoc (HMM E-Value=1.4) Length = 138 Score = 27.5 bits (58), Expect = 7.1 Identities = 10/42 (23%), Positives = 23/42 (54%) Frame = +1 Query: 319 KEKKGEKKQNAWVEMLQSVLDEQKSAPQNVRRIIETISKHNN 444 + K+ E+K +++++ DE++ + R+ +ETI N Sbjct: 40 RAKEAEEKNEYLSQLVKAYQDEKEKGSEETRKTLETIENEKN 81 >SB_37977| Best HMM Match : PP2C (HMM E-Value=8.6e-08) Length = 662 Score = 27.5 bits (58), Expect = 7.1 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +1 Query: 79 QNK*PQSTRVLQEMVVFTCSHCGESVQKPKVEKH 180 +N TR+ +V CS CGES+ +++ H Sbjct: 151 ENSSEGETRLALPNIVLPCSKCGESINICRLQSH 184 >SB_36223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 27.5 bits (58), Expect = 7.1 Identities = 11/34 (32%), Positives = 22/34 (64%), Gaps = 7/34 (20%) Frame = -3 Query: 510 WISFMSTD-------IFDKINKLRLLSWCIVMLA 430 W++F+ T +FD +++LR L+W +++LA Sbjct: 22 WVTFVGTSTFHGLHYLFDALSRLRKLAWALLLLA 55 >SB_15809| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 935 Score = 27.5 bits (58), Expect = 7.1 Identities = 17/45 (37%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = +1 Query: 121 VVFTCSHCG-ESVQKPKVEKHYLTKCRNKNPNLSCMDCFKDFLGK 252 VVF CS+C ES K EKH ++ + SC C + F K Sbjct: 3 VVFKCSYCAIESSDKEVAEKH-VSSGDCLSLEFSCPTCGRTFQSK 46 >SB_52263| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1024 Score = 27.5 bits (58), Expect = 7.1 Identities = 18/72 (25%), Positives = 36/72 (50%), Gaps = 1/72 (1%) Frame = +1 Query: 133 CSHCGESVQKPKVEKHYLTKCRNKNPNLSCMDCFKDFLGK-DYESHIKCITEEERYSGKG 309 C CG+ + ++ + L R+K PNL +D +K + + ++ + + E +Y+G G Sbjct: 815 CEDCGKPYIRLRLCRALLQAARHKGPNLVKVDAYKGTVVEVPLDAVLNGLPLEWKYAGWG 874 Query: 310 FTAKEKKGEKKQ 345 T +G+ Q Sbjct: 875 -TVHRMQGKTIQ 885 >SB_38457| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 4303 Score = 27.5 bits (58), Expect = 7.1 Identities = 14/57 (24%), Positives = 24/57 (42%) Frame = +1 Query: 130 TCSHCGESVQKPKVEKHYLTKCRNKNPNLSCMDCFKDFLGKDYESHIKCITEEERYS 300 TC CG+ P+ +++ K C+ C + F K ++ C +E E S Sbjct: 2824 TCELCGKKFCTPEYVAKHVSMVHGKERPYRCIHCDRGFTSKINLTNHPCRSEVESSS 2880 >SB_19487| Best HMM Match : dsDNA_bind (HMM E-Value=5.2) Length = 126 Score = 27.5 bits (58), Expect = 7.1 Identities = 12/44 (27%), Positives = 21/44 (47%) Frame = +1 Query: 352 WVEMLQSVLDEQKSAPQNVRRIIETISKHNNTPRKKPKFINFVK 483 W EM+ + + ++ A Q ++E + K KK KF+ K Sbjct: 60 WKEMILAATEARERAEQEKLTLVEKVQKLEELCSKKDKFVMVTK 103 >SB_157| Best HMM Match : dsDNA_bind (HMM E-Value=5.2) Length = 97 Score = 27.5 bits (58), Expect = 7.1 Identities = 12/44 (27%), Positives = 21/44 (47%) Frame = +1 Query: 352 WVEMLQSVLDEQKSAPQNVRRIIETISKHNNTPRKKPKFINFVK 483 W EM+ + + ++ A Q ++E + K KK KF+ K Sbjct: 31 WKEMILAATEARERAEQEKLTLVEKVQKLEELCSKKDKFVMVTK 74 >SB_54976| Best HMM Match : MFS_1 (HMM E-Value=0.00064) Length = 538 Score = 27.1 bits (57), Expect = 9.4 Identities = 20/71 (28%), Positives = 33/71 (46%), Gaps = 4/71 (5%) Frame = +2 Query: 14 TTYTSENKILI-IFKFKVIHFAFKTNSPNPHVFY---KKWLFLHAVIVGSLFRSPKWKSI 181 T YT ++ L + FKV++ S + + WLFL ++ + + W S Sbjct: 392 TVYTFSDRFLSHVGHFKVVYMGLLCYSLRFFYYSYCTRPWLFLPIELIQGVTTAAVWTSF 451 Query: 182 ISLNVGIKTQI 214 +S VG KT+I Sbjct: 452 VSY-VGSKTEI 461 >SB_13308| Best HMM Match : MFS_1 (HMM E-Value=0.0008) Length = 700 Score = 27.1 bits (57), Expect = 9.4 Identities = 21/70 (30%), Positives = 32/70 (45%), Gaps = 2/70 (2%) Frame = +1 Query: 316 AKEKKGEKKQNAWVEMLQSVLDEQKSAPQNVRRIIET-ISKHNNTPRKKPKFI-NFVKNV 489 AK KK+NA V + S L ++ V+ E+ I K N +K P +I N K Sbjct: 187 AKPSNQNKKENATVMLGASGLTNKEMEDAKVQSEKESEIEKKNPNKKKAPMYINNKEKKE 246 Query: 490 CGHKTNPKDI 519 H N +++ Sbjct: 247 ITHSGNSEEV 256 >SB_3213| Best HMM Match : zf-C2H2 (HMM E-Value=3.8e-40) Length = 595 Score = 27.1 bits (57), Expect = 9.4 Identities = 15/50 (30%), Positives = 21/50 (42%) Frame = +1 Query: 94 QSTRVLQEMVVFTCSHCGESVQKPKVEKHYLTKCRNKNPNLSCMDCFKDF 243 QST TCS CG+S P+ + ++ + P C C K F Sbjct: 424 QSTGNTITKATCTCSFCGKSFGNPRALELHVRRHSGHRP-YDCQFCSKSF 472 >SB_52786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 392 Score = 27.1 bits (57), Expect = 9.4 Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 2/50 (4%) Frame = +1 Query: 124 VFTCSHCGESVQKP-KVEKHYLTKCRNKNPNLSCMDCFKDFLGK-DYESH 267 VF C CG+ ++P + H L +K +C C K FL K D + H Sbjct: 272 VFRCLECGKEFRRPSSLSTHKLIHSDHK--PYACTYCDKKFLRKSDMKKH 319 >SB_51861| Best HMM Match : RVT_1 (HMM E-Value=1.2e-10) Length = 1318 Score = 27.1 bits (57), Expect = 9.4 Identities = 13/42 (30%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = +1 Query: 91 PQSTRVLQE-MVVFTCSHCGESVQKPKVEKHYLTKCRNKNPN 213 P++T V Q M+ TC++ + ++ K YL +C+ +NP+ Sbjct: 759 PEATPVAQRPMLPTTCNNPLRNGSIRELNKAYLNRCQRENPS 800 >SB_42201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 27.1 bits (57), Expect = 9.4 Identities = 31/143 (21%), Positives = 54/143 (37%), Gaps = 5/143 (3%) Frame = +1 Query: 73 CIQNK*PQSTRVLQEMVVFTCSHCGESVQKPKVEKHYLTKCRNKNPNLSCMDCFKDFLGK 252 C+ K +Q++ F + + KP + + Y C + P + F D L K Sbjct: 210 CMSAKGSLDAASVQQIKQFGLNMQRRLLMKPDIGRKYAALCSPQVPFTDML--FGDDLQK 267 Query: 253 DYESHIK----CITEEE-RYSGKGFTAKEKKGEKKQNAWVEMLQSVLDEQKSAPQNVRRI 417 + IK C + + R SG + + +K A + + + + AP Sbjct: 268 HLKDIIKLGPSCSQKRDPRASGPLKSTTTEGAQKTGTAKITSFGNEGSQLRRAPSRASAH 327 Query: 418 IETISKHNNTPRKKPKFINFVKN 486 S NNT + KF+ F+ N Sbjct: 328 HSRPSLLNNTKSQTAKFLGFILN 350 >SB_12715| Best HMM Match : Adeno_E1A (HMM E-Value=1.3) Length = 909 Score = 27.1 bits (57), Expect = 9.4 Identities = 13/55 (23%), Positives = 27/55 (49%) Frame = +1 Query: 355 VEMLQSVLDEQKSAPQNVRRIIETISKHNNTPRKKPKFINFVKNVCGHKTNPKDI 519 V +L+ + KS P NV + ++ + N + +N +N CG + +P ++ Sbjct: 193 VRLLKKTRTDDKSGPSNVTLLSQSRHEDNESVPSSVTLLNQSRNECG-EIDPSNV 246 >SB_8983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 606 Score = 27.1 bits (57), Expect = 9.4 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 2/32 (6%) Frame = +3 Query: 54 NLRLYI-LHS-KQIAPIHTCFTRNGCFYMQSL 143 +++ Y LH+ K+IAP H CF+R C +L Sbjct: 8 SMKFYFRLHTNKRIAPAHACFSRLRCLIETTL 39 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,656,474 Number of Sequences: 59808 Number of extensions: 349870 Number of successful extensions: 1079 Number of sequences better than 10.0: 33 Number of HSP's better than 10.0 without gapping: 980 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1077 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -