BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS309H10f (521 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81587-5|CAB04706.1| 369|Caenorhabditis elegans Hypothetical pr... 30 1.2 Z71186-4|CAA94916.1| 867|Caenorhabditis elegans Hypothetical pr... 29 2.7 U00052-10|AAK21429.2| 289|Caenorhabditis elegans Rnp (rrm rna b... 27 8.1 >Z81587-5|CAB04706.1| 369|Caenorhabditis elegans Hypothetical protein T06G6.7 protein. Length = 369 Score = 29.9 bits (64), Expect = 1.2 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = -1 Query: 437 NRPXXGVXGSLXGXAXSFXRGLFGRVYGXVEGIFG 333 N P V G L + GLF R+ +EGIFG Sbjct: 189 NYPEFSVYGRLCNEFSAIHDGLFHRIQAVIEGIFG 223 >Z71186-4|CAA94916.1| 867|Caenorhabditis elegans Hypothetical protein F23D12.5 protein. Length = 867 Score = 28.7 bits (61), Expect = 2.7 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +1 Query: 97 PRRHRKPPTL*KTRSRRRASLLVEPRN 177 P R RKP TL +T+S++R S P N Sbjct: 206 PSRKRKPETLIETKSKKRKSARGRPSN 232 >U00052-10|AAK21429.2| 289|Caenorhabditis elegans Rnp (rrm rna binding domain) containingprotein 5 protein. Length = 289 Score = 27.1 bits (57), Expect = 8.1 Identities = 19/41 (46%), Positives = 22/41 (53%) Frame = +1 Query: 61 STGRRRMQSNLPPRRHRKPPTL*KTRSRRRASLLVEPRNPP 183 S RRR S PPRR R+ + +R RRRAS PR P Sbjct: 90 SPPRRRRPSPSPPRRDRRDRS--GSRQRRRAS----PRRSP 124 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,670,648 Number of Sequences: 27780 Number of extensions: 140618 Number of successful extensions: 293 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 280 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 291 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1017709248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -