BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS309H06f (521 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q4CZY8 Cluster: Putative uncharacterized protein; n=1; ... 34 2.3 UniRef50_Q22KK6 Cluster: DHHC zinc finger domain containing prot... 33 4.0 >UniRef50_Q4CZY8 Cluster: Putative uncharacterized protein; n=1; Trypanosoma cruzi|Rep: Putative uncharacterized protein - Trypanosoma cruzi Length = 667 Score = 33.9 bits (74), Expect = 2.3 Identities = 16/43 (37%), Positives = 26/43 (60%) Frame = -3 Query: 201 NIQYWPFTTVFFSILNIK*VSTKNYYNKKINDHWFFTELSLAS 73 N +WPFTT++ + I V T++Y++ N+ TEL +AS Sbjct: 577 NHTHWPFTTIWNATRTIIDVDTRSYHHSAANNSASRTELLMAS 619 >UniRef50_Q22KK6 Cluster: DHHC zinc finger domain containing protein; n=2; Eukaryota|Rep: DHHC zinc finger domain containing protein - Tetrahymena thermophila SB210 Length = 1751 Score = 33.1 bits (72), Expect = 4.0 Identities = 18/57 (31%), Positives = 26/57 (45%), Gaps = 8/57 (14%) Frame = -2 Query: 304 FISPYFAESNIDKIIY*NMERNLQHCLEAIKCVTQY--------TILAFYNSLFFYF 158 + +PYF E K Y N +HCL +C++ Y +A N LFF+F Sbjct: 1630 YTAPYFFEKRYCKYCYINQPTRSKHCLICNRCISTYDHHCPWIGVCIAQRNHLFFFF 1686 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 403,043,122 Number of Sequences: 1657284 Number of extensions: 6645791 Number of successful extensions: 12303 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12003 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12300 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 32619212418 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -