BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS309H06f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-toler... 22 3.8 DQ494421-1|ABF55372.1| 73|Tribolium castaneum telomerase rever... 21 5.0 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 21 5.0 >EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-tolerant protein. Length = 516 Score = 21.8 bits (44), Expect = 3.8 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = +1 Query: 418 PLSESCLYRIVSVV*VHKHFYNTVXNNN 501 P +ES +Y V ++ VH+ ++ N N Sbjct: 187 PRTESAVYEPVRIMGVHRPGFDNDCNKN 214 >DQ494421-1|ABF55372.1| 73|Tribolium castaneum telomerase reverse transcriptase protein. Length = 73 Score = 21.4 bits (43), Expect = 5.0 Identities = 16/59 (27%), Positives = 25/59 (42%) Frame = +1 Query: 91 RKEPVIVNFLVIIILSRYLLNV*NRKKDCCKRPILYIVLHI*LLPNNVVNFVPYFSRLF 267 +K P IVN IL+ L N KK K+P+ + L ++P + R + Sbjct: 13 QKAPKIVNSKYNSILNIALKNFRLCKKHKTKKPVQILALLQEIIPKSYFGTTTNLKRFY 71 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 21.4 bits (43), Expect = 5.0 Identities = 16/59 (27%), Positives = 25/59 (42%) Frame = +1 Query: 91 RKEPVIVNFLVIIILSRYLLNV*NRKKDCCKRPILYIVLHI*LLPNNVVNFVPYFSRLF 267 +K P IVN IL+ L N KK K+P+ + L ++P + R + Sbjct: 13 QKAPKIVNSKYNSILNIALKNFRLCKKHKTKKPVQILALLQEIIPKSYFGTTTNLKRFY 71 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 106,810 Number of Sequences: 336 Number of extensions: 2144 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -