BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS309H06f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_0454 + 18364654-18366594 29 3.0 09_02_0553 - 10565450-10565529,10565652-10565792,10565793-10566219 27 6.9 >07_03_0454 + 18364654-18366594 Length = 646 Score = 28.7 bits (61), Expect = 3.0 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -3 Query: 270 IK*STKIWNEIYNIVWKQLNV*HNIQYW 187 IK S + ++ NIVW +LNV I++W Sbjct: 379 IKMSISVLDQWKNIVWNELNVQSRIKHW 406 >09_02_0553 - 10565450-10565529,10565652-10565792,10565793-10566219 Length = 215 Score = 27.5 bits (58), Expect = 6.9 Identities = 18/51 (35%), Positives = 28/51 (54%) Frame = -1 Query: 401 LINTVLIKETSKPHICLLKKIIRSKLF*KKLIFHKSLLCGIKYR*NNLLKY 249 LI+ V K+ S P L++++R + K+ FH ++ G K NLLKY Sbjct: 81 LIDLVETKDNS-PSSARLEELLRKENCRKETAFHDAVCIGNKDIITNLLKY 130 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,968,870 Number of Sequences: 37544 Number of extensions: 152181 Number of successful extensions: 228 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 227 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 228 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -