BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS309H06f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37499| Best HMM Match : 7tm_1 (HMM E-Value=4e-09) 27 7.1 SB_44183| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 >SB_37499| Best HMM Match : 7tm_1 (HMM E-Value=4e-09) Length = 378 Score = 27.5 bits (58), Expect = 7.1 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +1 Query: 235 VNFVPYFSRLFYLYLIPQSKDL*NISFF 318 V+F+PYF L +YL P +++ ++ F Sbjct: 301 VSFIPYFIALNIIYLYPHGENIVSLQVF 328 >SB_44183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 751 Score = 27.1 bits (57), Expect = 9.4 Identities = 17/65 (26%), Positives = 31/65 (47%) Frame = -3 Query: 225 WKQLNV*HNIQYWPFTTVFFSILNIK*VSTKNYYNKKINDHWFFTELSLASTRLGPEFST 46 W+Q+N +Q+ T FF+++ I ++Y K H+ +SL L P+F Sbjct: 318 WEQIN--QGVQFTQ-TRKFFTLIPIFLFMITSFYTKYDGIHFIINAVSLLLLSLVPKFPQ 374 Query: 45 KHCFN 31 + F+ Sbjct: 375 MYKFS 379 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,701,535 Number of Sequences: 59808 Number of extensions: 199750 Number of successful extensions: 325 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 308 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 325 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -