BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS309H06f (521 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81560-2|CAB04547.1| 1021|Caenorhabditis elegans Hypothetical pr... 29 2.7 Z79757-6|CAB02127.1| 350|Caenorhabditis elegans Hypothetical pr... 29 2.7 >Z81560-2|CAB04547.1| 1021|Caenorhabditis elegans Hypothetical protein K02E2.2 protein. Length = 1021 Score = 28.7 bits (61), Expect = 2.7 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = -2 Query: 277 NIDKIIY*NMERNLQHCLEAIKCVTQYTILAFYNSLF 167 NI K++ N+E QH E I + + + YN F Sbjct: 442 NISKVVQWNVEEVFQHSAEVIVALDDFVYASHYNDSF 478 >Z79757-6|CAB02127.1| 350|Caenorhabditis elegans Hypothetical protein F55B12.6 protein. Length = 350 Score = 28.7 bits (61), Expect = 2.7 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 3/56 (5%) Frame = +2 Query: 143 TYLMFKIEKKTVVKGQYCILCYTFNCF-QTML*ISFHILVDYFIY--I*FRKVRTY 301 T LM + + T+V QY +L +CF T+ + H + YF + FRKV+ + Sbjct: 74 TVLMRRSDSDTIVNLQYVLLILLCSCFGVTITFFAIHFVFRYFALERLVFRKVKHF 129 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,892,229 Number of Sequences: 27780 Number of extensions: 177668 Number of successful extensions: 347 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 346 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 347 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1017709248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -