BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS309H01f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0804 - 19844059-19844777,19844914-19844995,19846580-19846585 30 1.3 02_02_0620 + 12210812-12210997,12212397-12212474,12212744-122128... 29 1.7 11_01_0514 - 3985204-3985266,3985920-3986061,3986144-3986276,398... 28 4.0 >04_03_0804 - 19844059-19844777,19844914-19844995,19846580-19846585 Length = 268 Score = 29.9 bits (64), Expect = 1.3 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -1 Query: 89 GYSPV*PYIWDPPPVCP 39 G P P +W PPPVCP Sbjct: 235 GIRPWPPQVWPPPPVCP 251 >02_02_0620 + 12210812-12210997,12212397-12212474,12212744-12212848, 12212998-12213022,12213214-12213266,12213523-12213635, 12213777-12213801,12214560-12214601,12214666-12214726, 12216027-12216043,12217143-12217257,12217431-12218659 Length = 682 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/39 (35%), Positives = 24/39 (61%) Frame = -1 Query: 242 IQCELKQI*TY*NQDFKGILSKFCQVSVSNISKEI*KLL 126 I+C++K +Q+ KG+ SKF +V SN+ + + LL Sbjct: 448 IRCDIKVFKEIYSQETKGVHSKFVEVPPSNLHQHLGNLL 486 >11_01_0514 - 3985204-3985266,3985920-3986061,3986144-3986276, 3986703-3986817,3987496-3987549,3987787-3987912, 3989179-3989319,3989470-3989552,3989643-3989733, 3990318-3990405,3992705-3992832 Length = 387 Score = 28.3 bits (60), Expect = 4.0 Identities = 15/32 (46%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = -1 Query: 413 RMYKIAKEL-LVWHCTS*IGRTN*Y*ISHTTL 321 R+Y I KE +V HC++ IGRT Y H T+ Sbjct: 305 RLYGIPKEHPIVAHCSAGIGRTGAYITIHNTI 336 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,935,302 Number of Sequences: 37544 Number of extensions: 201831 Number of successful extensions: 417 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 393 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 417 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -