BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS309G07f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 25 1.5 AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi... 25 2.0 AJ459961-1|CAD31060.1| 700|Anopheles gambiae prophenoloxidase 8... 23 8.2 AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical prote... 23 8.2 AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical prote... 23 8.2 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 25.0 bits (52), Expect = 1.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +1 Query: 13 LSEGEKKLSHNILAILEHYKQPDP 84 LS GEK LS L HY +P P Sbjct: 1187 LSGGEKTLSSLALVFALHYYKPSP 1210 >AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoisomerase protein. Length = 1039 Score = 24.6 bits (51), Expect = 2.0 Identities = 8/27 (29%), Positives = 16/27 (59%) Frame = -3 Query: 288 VVAACLQFFESHHGVGLHCSDIGLNVI 208 ++ C+ F + HH CS++G+ +I Sbjct: 437 LILMCISFLQQHHQKPNACSNLGVLLI 463 >AJ459961-1|CAD31060.1| 700|Anopheles gambiae prophenoloxidase 8 protein. Length = 700 Score = 22.6 bits (46), Expect = 8.2 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +1 Query: 184 YGTNEFRLNYVKADIGAMEAHAVMTLEKLQARGNYTFATW 303 +G N + V D G V+T++ L + TFATW Sbjct: 52 FGPNSPASSQVSNDTGVPPT--VVTIKDLDELPDLTFATW 89 >AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 22.6 bits (46), Expect = 8.2 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +3 Query: 363 RGPSSRARR*NQSGKHRHGLIGQQHRCEPG 452 RGP S R ++ + + QQH+ +PG Sbjct: 461 RGPDSGTDRHSEKQQQQQSQHQQQHQHQPG 490 >AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 22.6 bits (46), Expect = 8.2 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +3 Query: 363 RGPSSRARR*NQSGKHRHGLIGQQHRCEPG 452 RGP S R ++ + + QQH+ +PG Sbjct: 461 RGPDSGTDRHSEKQQQQQSQHQQQHQHQPG 490 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.317 0.135 0.390 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 528,716 Number of Sequences: 2352 Number of extensions: 11423 Number of successful extensions: 22 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -