BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS309G05f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 26 0.23 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 23 2.2 AF263514-1|AAF74206.1| 127|Tribolium castaneum cytochrome P450 ... 23 2.2 AM292343-1|CAL23155.2| 301|Tribolium castaneum gustatory recept... 22 2.9 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 21 5.0 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 25.8 bits (54), Expect = 0.23 Identities = 22/81 (27%), Positives = 37/81 (45%), Gaps = 5/81 (6%) Frame = -3 Query: 504 LSCFFICHNTNRNNISKCTKILSQVFFFNVLLQSSYKQL--FNGG---TSFWSFNLFPWN 340 L +IC T + I ++ +F +L+ + YKQL F+G N F W+ Sbjct: 176 LKAGYICTKTRASLICLLAWFIAALFTSPMLVIAEYKQLDYFDGSKVPACHTLANTF-WS 234 Query: 339 CSYWLDNSSVNFVRPIILSFI 277 Y+L + F+ P+I+ I Sbjct: 235 ALYFLTIIFLFFIIPLIILLI 255 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 22.6 bits (46), Expect = 2.2 Identities = 5/12 (41%), Positives = 11/12 (91%) Frame = -3 Query: 225 GFWVFHYNYIYN 190 GFW+FH +++++ Sbjct: 665 GFWLFHCHFLFH 676 >AF263514-1|AAF74206.1| 127|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 127 Score = 22.6 bits (46), Expect = 2.2 Identities = 8/24 (33%), Positives = 17/24 (70%) Frame = +1 Query: 391 LFVAGLKQDIEEEDLREYFSTFGN 462 L + G+ QDI+++ ++E + FG+ Sbjct: 9 LSMMGVHQDIQDKVVQELYDIFGD 32 >AM292343-1|CAL23155.2| 301|Tribolium castaneum gustatory receptor candidate 22 protein. Length = 301 Score = 22.2 bits (45), Expect = 2.9 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +1 Query: 376 ATVKKLFVAGLKQDIEEEDLREYFST 453 A K+ + GLK DI++E+ R T Sbjct: 220 ANKTKILLVGLKIDIDQEEERNVVVT 245 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 21.4 bits (43), Expect = 5.0 Identities = 4/12 (33%), Positives = 11/12 (91%) Frame = -3 Query: 225 GFWVFHYNYIYN 190 G+W+FH +++++ Sbjct: 665 GYWLFHCHFLFH 676 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 115,510 Number of Sequences: 336 Number of extensions: 2362 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -